KEGG   Capra hircus (goat): 102178020
Entry
102178020         CDS       T02910                                 

Gene name
RUNX1
Definition
(RefSeq) runt related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
chx  Capra hircus (goat)
Pathway
chx04530  Tight junction
chx04659  Th17 cell differentiation
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102178020 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102178020 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102178020 (RUNX1)
   05202 Transcriptional misregulation in cancer
    102178020 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102178020 (RUNX1)
   05220 Chronic myeloid leukemia
    102178020 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102178020 (RUNX1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    102178020 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 102178020
NCBI-ProteinID: XP_017908092
LinkDB
Position
1
AA seq 456 aa
MNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLAD
HPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAEL
RNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
RHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQ
SQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTA
PDLTAFGDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMSSATRYHTYLPPP
YPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNP
SLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaatccatctagagacgttcacgatgccagcacgagccgccgcttcacgccgccttcc
accgcgctgagcccgggcaagatgagcgaggcgctgccgctgggcgccccggacgccggc
gccgccctagccggcaagctgaggagcggcgaccgcagcatggtggaggtgctggccgac
cacccgggcgagctggtgcgcaccgacagccccaacttcctctgctccgtgctgcccacg
cactggcgctgcaacaagactctgcccatcgctttcaaggtggtggctctgggggacgtt
ccggatggcactctggtgactgtgatggcaggcaatgatgaaaactactcagctgaactg
agaaatgcaaccgcagccatgaaaaaccaagttgcgagattcaatgacctcaggtttgtc
ggtcggagtggaagagggaaaagcttcactctgaccatcactgtcttcacaaacccaccg
caagtcgccacctaccacagagccatcaaaatcacggtggatggaccccgagaacctcga
agacatcgtcagaaactagatgatcagaccaagcccgggagcttgtccttttccgagcgg
ctcagtgaactggagcagctgcggcgaacggccatgagggtcagcccacaccacccagcc
cccacacccaaccctcgggcctccttgaaccactccactgcctttaaccctcagcctcag
agtcagatgcaggatacgaggcagatccagccgtccccaccgtggtcctacgatcagtcc
taccagtacctgggatccatcgcctctccctctgtccacccagccacacccatctcgcct
gggcgggccagcggcatgacaaccctctcagccgagctttccagtcgactttcaactgcg
cccgacctgacggccttcggcgacccgcgccagttccctgcgctgccctccatctccgac
ccccgcatgcactaccctggagctttcacctactccccgactcccgtcacgtcgggcatc
ggcatcggcatgtcggccatgagctcggccacgcgctaccacacgtacctgccgccgccc
taccccggctcgtcgcaggcacagggcggcccgttccaggccagctcgccgtcctaccac
ctgtactacggcgcgtcggccggctcctaccagttctccatggtgggcggcgagcgctcg
ccgccacgcatcctgccgccctgcaccaacgcgtccactggctcggcgctgctcaatccc
agcctcccgaaccagagcgacgtagtggaggctgagggcagccacagcaactcccccacc
aacatggcgcccgccgcgcgcctcgaggaggccgtgtggcggccctactga

DBGET integrated database retrieval system