KEGG   Capra hircus (goat): 102178068
Entry
102178068         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102178068
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102178068
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102178068
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102178068
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102178068
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102178068
NCBI-ProteinID: XP_017900215
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQKHVLVGRKNLRLLGQMTRLSPHLCLRDRKDFA
FPQEMVEGGQLQEAQALSVLHEMLQQSFNLFHPERSSAAWDTTLLKELRNGLLDQLVDLD
ACLGQLTGEEDSALGRMGPTLAVKRYFQGIHFYLKEKGYSDCAWETVRVEIMRSLSSSTS
LQERLRMMDGDVNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacctgtctcagaaacacgtgctggttggcaggaagaacctcaggctc
ctgggtcaaatgacgagactctcccctcacttgtgtctgcgggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccctctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacccagagcgctcctctgctgcctgg
gacaccaccctcctgaaggagctccgcaatggactcctggaccagcttgtcgacctggat
gcctgcctggggcagctgacgggagaggaagactctgccctgggaaggatgggccccacc
ctggccgtgaagaggtacttccagggcatccatttctacctgaaagagaagggatacagc
gactgcgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcaaccagc
ttgcaagaaaggctaagaatgatggatggagatgtgaactcaccttga

KEGG   Capra hircus (goat): 102178353
Entry
102178353         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102178353
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102178353
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102178353
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102178353
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102178353
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102178353
NCBI-ProteinID: XP_005683672
LinkDB
Position
8
AA seq 195 aa
MALVLSLLMALVLVSYGPGGSLGCDLSKNHVLVGRKNLRFLGQMGKLSPRFCLQERKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTERSSDAWNTTLLEKLRTGLHQQLDHLD
SCLVQVTGEKGSALGRMGPTVAVKRYFQGIRVYLQEKGYSNCAWEIVRMEIRRSLSSSVS
LQERLRMMDGDLSSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttggtgctctctctactcatggccctggtgctggtcagctatggcccaggagga
tccctgggctgtgacctgtctaagaaccacgtgctggttggcaggaagaacctcaggttc
ctgggccaaatggggaaactctcccctcgcttctgtctgcaggagagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtcctc
cacgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgatgcctgg
aacaccaccctcctggagaagctccgcactggactccatcagcagctggaccacctggac
tcctgtctggtgcaggtgactggagagaaaggctctgccctgggaaggatgggccccact
gtggccgtgaagaggtacttccagggcatccgtgtctacctgcaagagaagggatacagc
aactgcgcctgggaaattgtcagaatggaaatcaggagatccttgtcttcatcagtcagc
ttgcaagaaaggttaagaatgatggatggagacctgagctcaccttga

KEGG   Capra hircus (goat): 102179668
Entry
102179668         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102179668
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102179668
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102179668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102179668
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102179668
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102179668
NCBI-ProteinID: XP_017908296
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALLLVSYGPGGSLGCDLSQNHVLVDRKNLRLLGQMRRISPHACLQDRKDFP
FPQEMVEGGQLQEAQAFSVLHEMLQQSFNLFHTERSSAAWDTTLLEQLRTGLHQQLDHLD
ACLGQVTGEEDSARGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWEIVRLEIMRSLSSSVS
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctgctgctggtcagctatggcccaggagga
tccctgggctgtgacctgtctcaaaaccatgtgctggttgacaggaagaacctcaggctc
ctgggccaaatgaggagaatctcccctcatgcctgtctgcaggacagaaaagacttccct
ttcccccaggagatggtggagggtggccagctccaggaggcccaggccttctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggaccacctggac
gcctgcctggggcaggtgacgggagaggaagactctgcccggggaaggacgggccccacc
ctggccgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgcgcctgggaaatcgtcagactggaaatcatgagatccttgtcttcatcagtcagc
ttgcaagaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Capra hircus (goat): 102180392
Entry
102180392         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102180392
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102180392
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102180392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102180392
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102180392
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102180392
NCBI-ProteinID: XP_013832710
UniProt: A0A452DNQ7
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLIGRKNLTLLGEMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEPRAISVLHEMLQQSFNLFHTERSSAAWNTTVLEQLRTGLHQQLDDLD
ACLGQVMGEEDSGLGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWETVRVEIMRSLSSSVS
LQERLRMMDGDLSSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagttatggcccgggagga
tccctgggctgtgatctgtctcagaaccatgttctcattggcaggaagaacctcacgctc
ctgggcgaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggagcccagggccatctctgtgctc
catgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
aacaccacagtcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcctggggcaggtgatgggagaggaagactctggcctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagt
gactgcgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagtcagc
ttgcaagaaaggttaagaatgatggatggagacctgagctcaccttga

KEGG   Capra hircus (goat): 102180492
Entry
102180492         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102180492
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102180492
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102180492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102180492
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102180492
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102180492
NCBI-ProteinID: XP_017900128
LinkDB
Position
Un
AA seq 206 aa
MASENLPQGSTRHRLSQPSSSRIFPMAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLFGR
KNLRLLGEMRRISPRFCLQDRKDFAFPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTER
ASAAWDTTLLEQLRTGLHQQLDDLDACLGQVMGEEDSALGKTGPTLAVKRYFQGIHVYLQ
EKAYSDCAWETVRVEIMRSLSSSASL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacaccgtctcagccagcccagcagc
agccgcatcttccccatggccttcgtgctctctctactcatggccctggtgctggtcagc
tatggcccgggaggatccctgggctgtgacctgtctcagaaccacgtgctgtttggcagg
aagaacctcagactcctgggtgaaatgaggagaatctcccctcgcttttgtctgcaagac
agaaaagacttcgctttcccccaggagatggtggagggcggccagctccaggaggcccag
gccatctctgtgctccatgagatgctccagcagagcttcaacctcttccacacagagcgc
gcctctgctgcctgggacaccaccctcctggagcagctccgcactggactccatcagcag
ctggatgacctggacgcctgcctggggcaggtgatgggagaggaagactctgccctggga
aagacaggccccaccctggctgtgaagaggtacttccagggcatccatgtctacctgcaa
gaaaaggcatacagcgactgcgcctgggaaaccgtcagagtggaaatcatgagatccttg
tcttcatcagccagcttgtaa

KEGG   Capra hircus (goat): 108633271
Entry
108633271         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108633271
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108633271
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108633271
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108633271
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108633271
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108633271
NCBI-ProteinID: XP_005683677
LinkDB
Position
8
AA seq 217 aa
MASLRKHGIREPTSRFHQTPSHQPSSSRIFPMAFVLSLLMALVLVSYAPGGSLGCDLSQN
HVLVGRKNLMLLGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLQEAQAISVLHEMLQQSFN
LFHTVGSSAAWDTTLLEQLRTGLHQQLDHLDACLGQVMGEEDSALGRMGPTLAVKRYFQG
IHVYLQEKEYSDCAWETVRVEIMRSLSSSVSLQERLR
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcctcacttagaaagcatggcatcagagaacctacctcaaggttccaccagacaccg
tctcaccagcccagcagcagccgcatcttccccatggccttcgtgctctctctactcatg
gccctggtgctggtcagctacgccccaggaggatccctgggctgtgacctgtctcagaac
cacgtgctggttggcaggaagaacctaatgttgctgggccaaatgaggagactctcccct
cgcttctgtctgcaagacagaaaagacttcgctttcccccaggagatggtggagggcggc
cagctccaggaggcccaggccatctctgtgctccacgagatgctccagcagagcttcaac
ctcttccacacagtgggctcctctgctgcctgggacaccaccctcctggagcagctccgc
actggactccatcagcagctggaccacctggacgcctgcctggggcaggtgatgggagag
gaagactctgccctgggaaggatgggccccaccctggccgtgaagaggtacttccagggc
atccatgtctacctgcaagagaaggaatacagcgactgtgcctgggaaaccgtcagagtg
gaaatcatgagatccttgtcttcatcagtcagcttgcaagaaaggttaagatga

KEGG   Capra hircus (goat): 108634604
Entry
108634604         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108634604
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108634604
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108634604
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108634604
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108634604
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108634604
NCBI-ProteinID: XP_017900129
LinkDB
Position
Un
AA seq 220 aa
MASENLPQGSTRRRLSQPSSSRIFPMAFMLSLLMALVLVSYGPGGSLGCDLSQNHVLVGR
KNLRLLGQMRRLSPRFCLQDRKDFTFPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTER
ASAAWDTTLLEQLRTGLHQQLDDLDACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLK
EKGYSDCAWEIVRLEIMRSLSSSVSLQERLRMMDGDLSSP
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacgccgtctcagccagcccagcagc
agccgcatcttccccatggccttcatgctctctctactcatggccctggtgctggtcagt
tatggcccgggaggatccctgggctgtgacctgtctcagaaccacgtgctggttggcagg
aagaacctcaggctcctgggccaaatgaggagactctcccctcgcttctgtctgcaggac
agaaaagacttcactttcccccaggagatggtggagggcggccagctccaggaggcccag
gccatctctgtgctccatgagatgctccagcagagcttcaacctcttccacacagagcgc
gcctctgctgcctgggacaccaccctcctggagcagctccgcactggactccatcagcag
ctggacgacctggacgcctgcctggggcaggtgatgggagaggaagactctgccctggga
aggacaggccccaccctggctgtgaagaggtacttccagggcatccatgtctacctgaaa
gagaagggatacagcgactgcgcctgggaaatcgtcagactggaaatcatgagatccttg
tcttcatcagtcagcttgcaagaaaggttaagaatgatggatggagacctgagctcacct
tga

KEGG   Capra hircus (goat): 108634662
Entry
108634662         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108634662
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108634662
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108634662
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108634662
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108634662
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108634662
NCBI-ProteinID: XP_017900213
LinkDB
Position
Un
AA seq 210 aa
MASENLPQGSPRHRLSQPSSSRIFPMAFVLSLLMALVLVSYGPGGSLGCDLSQNHMLVGS
QNLRILGQMRISPRFCLQDRKDFAFPQEMVEGSQLQEAQAISVLHEMLQQSFNLFHPESS
SAAWNTTLLEQLCTGLHQQLDHLDACLGQVMGGKDSALGRTDPTLAVKRYFQGIHVYLKE
KGYSDCAWDIVRLEIMRSLSSSASLQERLR
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttcacccagacaccgtctcagccagcccagcagc
agccgcatcttccccatggccttcgtgctctctctactcatggccctggtgctggtcagc
tatggcccgggaggatccctgggctgtgatctgtctcagaaccacatgctagttggcagc
cagaacctcaggatcctgggccaaatgagaatctcccctcgcttctgtctgcaggacaga
aaagacttcgctttcccccaggaaatggtggagggcagccagctccaggaggcccaggcc
atctctgtgctccacgagatgctccagcagagcttcaacctcttccacccagagagctcc
tctgctgcctggaacaccaccctcctggagcagctctgcactggactccatcagcagctg
gaccacctggacgcctgcctggggcaggtgatgggagggaaagactctgccctgggaagg
acagaccccaccctggctgtgaagaggtacttccagggcatccatgtctacctgaaagag
aagggatacagcgactgtgcctgggatatcgtcagactggaaatcatgagatccttgtct
tcatcagccagcttgcaagaaaggttaagatga

KEGG   Capra hircus (goat): 108634918
Entry
108634918         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108634918
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108634918
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108634918
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108634918
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108634918
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108634918
NCBI-ProteinID: XP_017900735
LinkDB
Position
Un
AA seq 181 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLFGRKNLRLLGQMRRISPRFCLQDRKDFA
FPQEMVEGGQLQEAQALSVLHEMLQKSFNLFHTERASAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGEEDSALGWTGPTLAVKRYFQGIHVYLQEKEYSDCAWETVRVEIMRSLSSSAS
L
NT seq 546 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctgtttggcaggaagaacctccggctc
ctgggccaaatgaggagaatctcccctcgcttttgtctgcaagacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccctctctgtgctc
catgagatgctccagaagagcttcaacctcttccacacagaacgcgcctctgctgcctgg
gacaccaccctcctggagcagctgcgcactggactccatcagcagctggacgacttggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggatggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgtgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagccagc
ttgtaa

KEGG   Capra hircus (goat): 108634973
Entry
108634973         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108634973
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108634973
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108634973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108634973
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108634973
SSDB
Motif
Pfam: Interferon DUF4205
Other DBs
NCBI-GeneID: 108634973
NCBI-ProteinID: XP_017900783
UniProt: A0A452DLW9
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLIGRKNLTLLGEMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTERSSAAWNTTVLEQLRTGLHQQLDDLD
ACLGQVMGEEDSGLGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWETVRVEIMRSLSSSVS
LQERLRMMDGDLSSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagttatggcccgggagga
tccctgggctgtgatctgtctcagaaccatgttctcattggcaggaagaacctcacgctc
ctgggcgaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
catgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
aacaccacagtcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcctggggcaggtgatgggagaggaagactctggcctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagt
gactgcgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagtcagc
ttgcaagaaaggttaagaatgatggatggagacctgagctcaccttga

KEGG   Capra hircus (goat): 108634976
Entry
108634976         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108634976
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108634976
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108634976
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108634976
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108634976
SSDB
Motif
Pfam: Interferon DUF1290
Other DBs
NCBI-GeneID: 108634976
NCBI-ProteinID: XP_017900785
LinkDB
Position
Un
AA seq 206 aa
MASENLPQGSTRRRLSQTSSSRIFPMAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLFGR
KNLRLLGQMRRISPRFCLQDRKDFAFPQEMVEGSQLQEAQAISVLHEMLQQSFNLFHPER
ASAAWDTTLLEQLRTGLHQQLDDLDACLWQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQ
EKGYSDCAWETVRVEIMRSLSSSASL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacgccgtctcagccagaccagcagc
agccgcatcttccccatggccttcgtgctctctctactcatggccctggtgctggtcagc
tacggcccaggaggatccctgggctgtgacctgtctcagaatcacgtgctgtttggcagg
aagaacctcagactcctgggccaaatgaggagaatctcccctcgtttctgtctgcaggac
agaaaagacttcgctttcccccaggagatggtggagggcagccagctccaggaggcccag
gccatctctgtgctccacgagatgctccagcagagcttcaacctcttccacccagagcgc
gcctctgctgcctgggacaccaccctcctggagcagctccgcactggactccatcagcag
ctggacgacctggacgcctgcctgtggcaggtgatgggagaggaagactctgccctggga
aggacgggtcccaccctggccgtgaagaggtacttccagggcatccatgtctacctgcaa
gagaagggatacagcgactgtgcctgggaaaccgtcagagtggaaatcatgagatccttg
tcttcatcagccagcttgtaa

KEGG   Capra hircus (goat): 108635000
Entry
108635000         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635000
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635000
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635000
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635000
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108635000
NCBI-ProteinID: XP_017900801
UniProt: A0A452E1Z8
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLVGRKNLRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFSLFHTGHVSAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGEEDSALGRMGPTLAVKRYFQGIHVYLEEKQYSDCAWEIVRVEIMRSLSSSVS
LQERLRMMDGDLSSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcaggaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaagacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcagcctcttccacacagggcacgtctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggatgggccccacc
ctggccgtgaagaggtacttccagggcatccatgtctacctggaagagaagcaatacagt
gactgcgcctgggaaattgtcagagtggaaatcatgagatccttgtcttcatcagtcagc
ttgcaagaaaggttaagaatgatggatggagacctgagctcgccttga

KEGG   Capra hircus (goat): 108635001
Entry
108635001         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635001
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635001
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635001
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635001
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108635001
NCBI-ProteinID: XP_017900802
LinkDB
Position
Un
AA seq 171 aa
MAQGGSLGCDLSQNHMLVGSQNLRILGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLQEAQ
AISVLHEMLQQSFNLFHTERASAAWDTTLLEQLRTGLHQQLDDLDACLGQVMGGEDSALG
RTGPTLVVKRYFQGIHVYLQEKEYSDCAWETVRLEIMRPLSSSASLQERLR
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcccagggaggatccctgggctgtgacttgtctcagaaccacatgctggttggcagc
cagaacctcaggatcctgggccaaatgaggagactttcccctcgcttctgtctgcaggac
agaaaagacttcgctttcccccaggagatggtggagggcggccagctccaggaggcccag
gccatctctgtgctccatgagatgctccagcagagcttcaacctcttccacacagagcgc
gcctctgctgcctgggacaccaccctcctggagcagctccgcactggactccatcagcag
ctggacgacctggacgcctgcctggggcaggtgatgggaggggaagactctgccctggga
aggacgggccccaccctggtcgtgaagaggtacttccagggcatccatgtctacctgcaa
gagaaggaatacagcgactgcgcctgggaaactgtcagactggaaatcatgagacccttg
tcttcatcagccagcttgcaagaaaggttaagatga

KEGG   Capra hircus (goat): 108635144
Entry
108635144         CDS       T02910                                 

Definition
(RefSeq) interferon tau-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635144
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635144
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635144
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635144
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108635144
NCBI-ProteinID: XP_017900904
LinkDB
Position
Un
AA seq 112 aa
MLQQSFNLFHPERSSAAWDTTLLEQLRTGIHQQLEDLDACLGQVMERKTLPGKDGPHPGC
EEVLPGHPCLPAREGIQRLRLEILRVEMMKALSSSTSLQERLRKMGGDLNSP
NT seq 339 nt   +upstreamnt  +downstreamnt
atgctccagcagagcttcaacctcttccacccagagcgctcctctgctgcctgggacacc
accctcctggagcagctccgcactggaatccatcagcagctggaagacctggacgcctgc
ctggggcaggtgatggagaggaagactctgcctgggaaggacgggccccaccctggctgt
gaagaggtacttccagggcatccatgtctacctgcaagagaagggatacagcgactgcgc
ctggaaatcctcagagtggagatgatgaaagccctctcgtcatcaaccagcttgcaagaa
aggttaagaaagatgggtggagatctgaactcaccttga

KEGG   Capra hircus (goat): 108635454
Entry
108635454         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635454
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635454
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635454
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635454
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108635454
NCBI-ProteinID: XP_017901068
UniProt: A0A452F943
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALALVSYSLGGSLGCDLSQNHMLIGRKNLRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQALSVLHEMLQQSFNLFHTERSSAAWDTTLLEQLRTGLHQQLEDLD
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKGYSDCAWEILRVEMMKALSSSTS
LQERLRKMGGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggctctggtcagctacagcctgggagga
tccctgggctgtgacctgtctcagaaccacatgctgattggcaggaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccctctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggaagacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaagggatacagc
gactgcgcctgggaaatcctcagagtggagatgatgaaagccctctcgtcatcaaccagc
ttgcaagaaaggttaagaaagatgggtggagatctgaactcaccttga

KEGG   Capra hircus (goat): 108635455
Entry
108635455         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635455
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635455
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635455
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635455
SSDB
Motif
Pfam: Interferon DUF4205
Other DBs
NCBI-GeneID: 108635455
NCBI-ProteinID: XP_017901070
UniProt: A0A452F846
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLVGRKNIRLLGQMRRLSPRFCLQDRKDFA
FPQDLVEGGQLQEAQAISVLHEMLQQSFNLFHTESSSAAWNTTLLQQLRTGLHQQLDDLD
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWETVRVEIMRSLSSSTS
LQEMLRMMDGDLNSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcaggaagaacatcagactc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggatttggtggaaggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacacagagagctcctctgctgcctgg
aacaccaccctcctgcagcagctccgcactggactccatcagcagctggacgacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgtgcctgggaaactgtcagagtggaaatcatgagatccttgtcttcatcaaccagc
ttgcaagaaatgttaagaatgatggatggagacctgaactcatcttga

KEGG   Capra hircus (goat): 108635503
Entry
108635503         CDS       T02910                                 

Gene name
IFN-tau
Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635503 (IFN-tau)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635503 (IFN-tau)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635503 (IFN-tau)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635503 (IFN-tau)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635503 (IFN-tau)
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108635503
NCBI-ProteinID: XP_017901107
LinkDB
Position
Un
AA seq 220 aa
MASENLPQGSPRRRLSQPSSSRIFPMAFVLSLLMALALVSYSLGGSLGCDLSQNHMLIGR
KNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLQEAQALSVLHEMLQQSFNLFHPER
SSAAWDTTLLEQLRTGIHQQLEDLDACLGQVMGEEDSALGRTGPTLAVKRYFQGIRVYLQ
EKEYSDCAWEILRVEMMKALSSSTSLQERLRKMGGDLNSP
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttcccccagacgccgtctcagccagcccagcagc
agccgcatcttccccatggccttcgtgctctctctactcatggccctggctctggtcagc
tacagcctgggaggatccctgggctgtgacctgtctcagaaccacatgctgattggcagg
aagaacctcaggctcctgggccaaatgaggagactctcccctcgcttctgtctgcaggac
agaaaagacttcgctttcccccaggagatggtggagggcggccagctccaggaggcccag
gccctctctgtgctccacgagatgctccagcagagcttcaacctcttccacccagagcgc
tcctctgctgcctgggacaccaccctcctggagcagctccgcactggaatccatcagcag
ctggaagacctggacgcctgcctggggcaggtgatgggagaggaagactctgccctggga
aggacgggccccaccctggccgtgaagaggtacttccagggcatccgtgtctacctgcaa
gagaaggaatacagcgactgcgcctgggaaatcctcagagtggagatgatgaaagccctc
tcgtcatcaaccagcttgcaagaaaggttaagaaagatgggtggagatctgaactcacct
tga

KEGG   Capra hircus (goat): 108635507
Entry
108635507         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635507
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635507
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635507
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635507
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635507
SSDB
Motif
Pfam: Interferon DUF4205 DIRP
Other DBs
NCBI-GeneID: 108635507
NCBI-ProteinID: XP_017901111
LinkDB
Position
Un
AA seq 186 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLFGSQNLRILGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAVSVLHEMLQQSFNLFRTESSSAAWDTTLLQQLRTGLHQQLDDLD
ACLGQVMGEEDSGLGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWGIVRMEIMRSLSSSAS
LQERLR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctgtttggcagccagaacctcaggatc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccgtctctgtgctc
cacgagatgctccagcagagcttcaacctcttccgcacagagagctcctctgctgcctgg
gacaccaccctcctgcagcagctccgcactggactccatcagcagctggacgacctggac
gcctgcctggggcaggtgatgggagaggaagactctggcctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgcgcctggggaatcgtcagaatggaaatcatgagatccttgtcttcatcagccagc
ttgcaggaaaggttaagatga

KEGG   Capra hircus (goat): 108635561
Entry
108635561         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635561
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635561
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108635561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635561
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635561
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108635561
NCBI-ProteinID: XP_017901145
LinkDB
Position
Un
AA seq 181 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLFGRKNLRLLGQMRRISPRFCLQDRKDFA
FPQEMVEGGQLQEAQALSVLHEMLQKSFNLFHTERASAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGEEDSALGWTGPTLAVKRYFQGIHVYLQEKEYSDCAWETVRVEIMRSLSSSAS
L
NT seq 546 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctgtttggcaggaagaacctccggctc
ctgggccaaatgaggagaatctcccctcgcttttgtctgcaagacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccctctctgtgctc
catgagatgctccagaagagcttcaacctcttccacacagaacgcgcctctgctgcctgg
gacaccaccctcctggagcagctgcgcactggactccatcagcagctggacgacttggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggatggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgtgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagccagc
ttgtaa

KEGG   Capra hircus (goat): 108636595
Entry
108636595         CDS       T02910                                 

Definition
(RefSeq) interferon tau-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636595
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636595
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636595
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636595
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636595
NCBI-ProteinID: XP_017908251
LinkDB
Position
8
AA seq 184 aa
MLPCGIDQWLFISSVMTLMMKDIRFPQEQVSGGQLQEAQAISVLHEMLQQSFNLFHTERA
SAAWDTTLLEQLRTGLHQQLDDLDACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQE
KEYSDRAWETGRVEITRRFLCQQVPKKTQEVRRNLILSDSCPSSGSSLFSLFQNSNFCLS
YERV
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcttccttgtggaattgaccagtggctcttcatctcctcagtgatgacactcatgatg
aaagacatcagattccctcaggagcaggtgagtggcggccagctccaggaggcccaggcc
atctctgtgctccacgagatgctccagcagagcttcaacctcttccacacagagcgcgcc
tctgctgcctgggacaccaccctcctggagcagctccgcactggactccatcagcagctg
gacgacctggacgcctgcctggggcaggtgatgggagaggaagactctgccctgggaagg
acgggccccaccctggccgtgaagaggtacttccagggcatccatgtctacctgcaagag
aaggaatacagcgaccgcgcctgggaaactggcagagtggaaatcacgaggcgctttctg
tgtcaacaagttcctaagaaaactcaggaagttagaaggaacctgatcctcagtgactcg
tgtcctagctcaggctcttcattgttcagtcttttccaaaactccaatttctgcctcagc
tatgagagagtttga

KEGG   Capra hircus (goat): 108636612
Entry
108636612         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636612
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636612
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636612
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636612
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636612
NCBI-ProteinID: XP_017908286
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQKHMLVGRKNLRLLDKMRRLSPHLCLQDRKDFA
FPQEMVEGGQLQEAQALSVLHEMLQQSFNLFHPEHSSAAWNTTLLKQLRNGLLDQLVDLD
ACLGQDMGEEDSALGRTGPTLAVKRYFQGIHFYLQEKGYSDCAWETVRVEIMRSLSSSTS
LQERLRMMDGDVKSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcctttgtgctctctctgctcatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacctgtctcagaaacacatgctggttggcaggaagaacctcaggctc
ctggacaaaatgagaagactctcccctcacttgtgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggaaggcggccagctccaggaggcccaggccctctctgtgctc
catgagatgctccagcagagcttcaacctcttccacccagagcactcctctgctgcctgg
aacaccaccctcctgaagcagctccgcaatggactcctggaccagcttgtcgacctggat
gcctgcctggggcaggatatgggagaggaagactctgccctgggaaggacaggccccacc
ctggccgtgaagaggtacttccagggcatccatttctacctgcaagagaagggatacagc
gactgcgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcaaccagc
ttgcaagaaaggctaagaatgatggatggagatgtgaagtcaccttga

KEGG   Capra hircus (goat): 108636613
Entry
108636613         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636613
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636613
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636613
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636613
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636613
SSDB
Motif
Pfam: Interferon DUF4205 DIRP
Other DBs
NCBI-GeneID: 108636613
NCBI-ProteinID: XP_017908287
LinkDB
Position
8
AA seq 186 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLFGSQNLRILGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAVSVLHEMLQQSFNLFRTESSSAAWDTTLLQQLRTGLHQQLDDLD
ACLGQVMGEEDSGLGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWGIVRMEIMRSLSSSAS
LQERLR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctgtttggcagccagaacctcaggatc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccgtctctgtgctc
cacgagatgctccagcagagcttcaacctcttccgcacagagagctcctctgctgcctgg
gacaccaccctcctgcagcagctccgcactggactccatcagcagctggacgacctggac
gcctgcctggggcaggtgatgggagaggaagactctggcctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgcgcctggggaatcgtcagaatggaaatcatgagatccttgtcttcatcagccagc
ttgcaggaaaggttaagatga

KEGG   Capra hircus (goat): 108636615
Entry
108636615         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636615
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636615
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636615
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636615
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636615
NCBI-ProteinID: XP_017908288
LinkDB
Position
8
AA seq 185 aa
MAFVLSLLMALALVSYGPGGSLGCDLSQNHMLVGSQNLRILGQMRISPRFCLQDRKDFTF
PQEMVEGGQLHEAQAISVLHEMLQQSFNLFHTERASAAWNTTLLEQLRTGLHQQLDHLDT
CLGQVMGGEDSALGRTGPTLAVKRYFQGIHVYLKEKGYSDCAWDIVRLEIMRSFSSSASL
QERLR
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggcgctggtcagctatggcccgggagga
tccctgggctgtgatctgtctcagaaccacatgctagttggcagccagaacctcaggatc
ctgggccagatgagaatctcccctcgcttctgtctgcaggacagaaaagacttcactttc
ccccaggagatggtggaaggcggccagcttcatgaagcccaggccatctctgtgctccac
gagatgctccagcagagcttcaacctcttccacacagagcgcgcctctgctgcctggaac
accaccctcctggagcagctccgcactggactccatcagcagctggaccacctggacacc
tgcctggggcaggtgatgggcggggaagactctgccctgggaaggacaggccccaccctg
gctgtgaagaggtacttccagggcatccatgtctacctgaaagagaagggatacagcgac
tgtgcctgggatatcgtcagactggaaatcatgagatccttctcttcatcagccagcttg
caagaaaggttaagatga

KEGG   Capra hircus (goat): 108636616
Entry
108636616         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636616
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636616
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636616
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636616
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636616
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108636616
NCBI-ProteinID: XP_017908289
UniProt: A0A452DR89
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLIGRKNFRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFLTESSSAAWNTTLLQQLRTGLHQQLDHLD
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWETVRVEIMRSLSSSVS
LQERLRMMDGDLSSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagttatggcccgggagga
tccctgggctgtgacctgtctcagaaccatgttctcattggcaggaagaacttcaggctc
ctgggccaaatgaggagactttcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctcttcctcacagagagctcctctgctgcctgg
aacaccaccctcctgcagcagctccgcactggactccatcagcagctggaccacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgtgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagtcagc
ttgcaagaaaggttaagaatgatggatggagacctgagctcgccttga

KEGG   Capra hircus (goat): 108636617
Entry
108636617         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636617
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636617
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636617
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636617
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636617
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108636617
NCBI-ProteinID: XP_017908290
UniProt: A0A452DN00
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCVLSQNHALIGRKNFRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTDRSSAAWNTTLLEQLRTGLHQQLDDLD
AWLGQVMGEEDSTLGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWETVRVEIMRSLSSSVS
LQERLRMMDGDLSSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagttatggcccgggagga
tccctgggctgtgtcctgtctcagaaccatgctctcattggcaggaagaacttcaggctc
ctgggccaaatgaggagactttcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
catgagatgctccagcagagcttcaaccttttccacacagatcgctcctctgctgcctgg
aacaccaccctcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctggctggggcaggtgatgggagaggaagactctaccctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgtgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagtcagc
ttgcaagaaaggttaagaatgatggatggagacctgagctcaccttga

KEGG   Capra hircus (goat): 108636618
Entry
108636618         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636618
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636618
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636618
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636618
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636618
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636618
NCBI-ProteinID: XP_017908292
UniProt: A0A452E0E0
LinkDB
Position
8
AA seq 195 aa
MAFVLFLLMALVLVSYGPGGSLGCDLSQNHVLVGRKNLRLLGEMRRISPRFCLQDRKDFD
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTERSSAAWDTTLLEQLHTGLHQQLDHLD
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKGYSDCTWETVRVEIMRSLSSSAS
LYERLRMMDGDLNSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctttctactcatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcaggaagaacctcagactc
ctgggtgaaatgaggagaatctcccctcgcttctgtctgcaagacagaaaagacttcgat
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagtttcaacctctttcacacagagcgctcctctgctgcctgg
gacaccactctcctggagcagctccacactggactccatcagcagctggaccacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagaaaagggatacagc
gactgcacctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagccagc
ttgtacgaaaggttaagaatgatggatggagacctaaactcatcttga

KEGG   Capra hircus (goat): 108636620
Entry
108636620         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636620
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636620
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636620
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636620
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108636620
NCBI-ProteinID: XP_017908293
UniProt: A0A452EDS7
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSHGPEGSLGCDLSQNHMLVGRKNLRLLGQMRRLSSRFCLQDRKDFA
FPQEMVEGDQLQEAQAISVLHEMLQQSFNLFHTERTSAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKGYSDCAWEILRVEMMKALSSSTS
LQERLRKMGGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagccatggcccagaagga
tccctgggctgtgacctgtcccagaaccacatgctggttggcaggaagaacctcagactc
ctgggccaaatgaggagactctcctctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggtgaccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacacagagcgcacctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcaacagctggacgacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaagggatacagc
gactgcgcctgggaaatcctcagagtggagatgatgaaagccctctcgtcatcaaccagc
ttgcaagaaaggttaagaaagatgggtggagatctgaactcaccttga

KEGG   Capra hircus (goat): 108636623
Entry
108636623         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636623
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636623
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636623
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636623
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108636623
NCBI-ProteinID: XP_017908298
UniProt: A0A452DYA5
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSCGPGGSLGCDLSQNHMLVGRKNLRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQALSVLHEMLQQSFNLFHTERSSAAWDTTLLQQLRTGLHQQLDDLD
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKGYSDCAWEILRVEMMKALSSSTS
LQERLRKMGGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctgtggcccaggagga
tcactgggctgtgacctgtcccagaaccacatgctggttggcaggaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccctctctgtgctc
catgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
gacactaccctcctgcagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggacgggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaagggatacagc
gactgcgcctgggaaatcctcagagtggagatgatgaaagccctctcgtcatcaaccagc
ttgcaagaaaggttaagaaagatgggtggagatctgaactcaccttga

KEGG   Capra hircus (goat): 108636624
Entry
108636624         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636624
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636624
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636624
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636624
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636624
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108636624
NCBI-ProteinID: XP_017908301
LinkDB
Position
8
AA seq 186 aa
MAFVLSLLMAPVLVSYGPGGSLGCDLSQNHMLVGSQNLRILGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTERASAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGGEDSALGRTGPTLVVKRYFQGIHVYLQEKEYSDCAWETVRLEIMRPLSSSAS
LQERLR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccccggtgctggtcagttatggcccaggagga
tccctgggctgtgacttgtctcagaaccacatgctggttggcagccagaacctcaggatc
ctgggccaaatgaggagactttcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
catgagatgctccagcagagcttcaacctcttccacacagagcgcgcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggacgacctggac
gcctgcctggggcaggtgatgggaggggaagactctgccctgggaaggacgggccccacc
ctggtcgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgcgcctgggaaactgtcagactggaaatcatgagacccttgtcttcatcagccagc
ttgcaagaaaggttaagatga

KEGG   Capra hircus (goat): 108636625
Entry
108636625         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636625
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636625
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636625
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636625
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636625
NCBI-ProteinID: XP_017908302
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQKHVLVGRKNLRLLGQMTRLSPHLCLRDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHPERSSAAWNTTLLKQLRNGLLDQLVDLD
ACLGQDMGEEDSALGRMDPTLAVKSYFQGIHFYLEEKGYRDCAWETVRVEIMRSLSSSAS
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacctgtctcagaaacacgtgctggttggcaggaagaacctcaggctc
ctgggccaaatgacgagactctcccctcacttgtgtctgcgggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacccagagcgctcctctgctgcctgg
aacaccaccctcctgaagcagctccgcaatggactcctggaccagcttgtcgacctggat
gcctgcctggggcaggatatgggagaggaagactctgccctgggaaggatggaccccacc
ctggctgtgaagagttacttccagggcatccatttctacctggaagagaagggatacaga
gactgcgcctgggaaaccgtcagagtggaaatcatgagatccttgtcttcatcagccagc
ttgcaagaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Capra hircus (goat): 108636626
Entry
108636626         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636626
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636626
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636626
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636626
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108636626
NCBI-ProteinID: XP_017908303
UniProt: A0A452E3H0
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCHLSQNHVLVGSQNLRLLGQMRRISPRFCLQDRKEFA
FPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTERASAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGEEDSALGRMGPTLAVKRYFQGIHVYLKEKGYSDCAWETVRVEIMRSLSSSAS
LHERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactcatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtcacctgtctcagaaccatgtgctggttggcagtcagaacctcaggctc
ctgggccaaatgaggagaatctcccctcgcttctgtctgcaggacagaaaagaattcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacacagagcgcgcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggatgggccccacc
ctggccgtgaagaggtacttccagggcatccatgtctacctgaaagagaagggatacagc
gactgcgcctgggaaaccgtcagagtggaaatcatgagatcattgtcttcatcagccagc
ttacacgaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Capra hircus (goat): 108636628
Entry
108636628         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636628
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636628
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636628
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636628
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 108636628
NCBI-ProteinID: XP_017908305
UniProt: A0A452E0W9
LinkDB
Position
8
AA seq 195 aa
MAFMLSLLMALALVSYSLGGSLGYDLSQNHMLIGRKNLRLLGQMRRISPRFCLQDRKDFA
FPQEMVEGAQLQEAQAISVLHEMLQQSFNLFHTERSSAAWDTTLLEQLRNGIHQQLDDLE
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKQYSDCAWETVRVEMMKALSSSTS
LQERLRKMGGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcatgctctctctactcatggccctggcgctggtcagctacagcctgggagga
tccctgggctatgacctgtctcagaaccacatgctgattggcaggaagaacctcagactc
ctgggccaaatgaggagaatctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcgcccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctctttcacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcaatggaatccatcagcagctggatgacctggag
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggacaggccccacc
ctggctgtgaagaggtacttccagggcatccatgtctacctgcaagagaagcaatacagt
gactgcgcctgggaaaccgtcagagtggagatgatgaaagccctctcatcatcaaccagc
ttgcaagaaaggttaagaaagatgggtggagatctgaactcaccttga

KEGG   Capra hircus (goat): 108636630
Entry
108636630         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636630
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636630
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108636630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636630
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636630
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636630
NCBI-ProteinID: XP_017908307
LinkDB
Position
8
AA seq 197 aa
MASENLPQGSTRHRLSQPSSSRIFPMAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLVGR
KNLMFLGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTEG
SSAAWDTTLLEQLRTGLHQQLDHLDACLGQVMGEEDSALGRMGPTLAVKRYFQGIHVYLK
EKGIQRLLPGKPSEWKS
NT seq 594 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacaccgtctcagccagcccagcagc
agccgcatcttccccatggccttcgtgctctctctactcatggccctggtgctggtcagc
tacggcccaggaggatccctgggctgtgacctgtctcagaaccacgtgctggttggcagg
aagaacctaatgttcctgggccaaatgaggagactctcccctcgcttctgtctgcaagac
agaaaagacttcgctttcccccaggagatggtggagggcggccagctccaggaggcccag
gccatctctgtgctccacgagatgctccagcagagcttcaacctcttccacacagagggc
tcctctgctgcctgggacaccaccctcctggagcagctccgcactggactccatcagcag
ctggaccacctggacgcctgcctggggcaggtgatgggagaggaagactctgccctggga
aggatgggccccaccctggccgtgaagaggtacttccagggcatccatgtctacctgaaa
gagaagggaatacagcgactgctgcctgggaaaccgtcagagtggaaatcatga

DBGET integrated database retrieval system