KEGG   Capra hircus (goat): 102178097
Entry
102178097         CDS       T02910                                 

Gene name
PXN
Definition
(RefSeq) paxillin
  KO
K05760  paxillin
Organism
chx  Capra hircus (goat)
Pathway
chx04062  Chemokine signaling pathway
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04670  Leukocyte transendothelial migration
chx04810  Regulation of actin cytoskeleton
chx05100  Bacterial invasion of epithelial cells
chx05135  Yersinia infection
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102178097 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102178097 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102178097 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102178097 (PXN)
   04062 Chemokine signaling pathway
    102178097 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102178097 (PXN)
   05203 Viral carcinogenesis
    102178097 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102178097 (PXN)
   05100 Bacterial invasion of epithelial cells
    102178097 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102178097 (PXN)
   05163 Human cytomegalovirus infection
    102178097 (PXN)
   05165 Human papillomavirus infection
    102178097 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:chx04990]
    102178097 (PXN)
Domain-containing proteins not elsewhere classified [BR:chx04990]
 LIM domain-containing proteins
  Paxillin family proteins
   102178097 (PXN)
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 102178097
NCBI-ProteinID: XP_017916625
LinkDB
Position
17
AA seq 590 aa
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPVPPPPSSEALNGT
VLDPLDSWPPSTSRFTHQQPQSSSPVYGSSAKTSSASNPQDGGGLPCPRAGEEDHVYSFP
NKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSTHY
GVPENNSLLGGKAGPLTKEKPKRNGGRGLEDLRPSVENLLDELESSVPSPVPAITVNQGE
MSSPQRVTSSQQQTRISASSATRELDELMASLSDFKIQGLEQRADGELRWVAGWPLNGRQ
SGPEGQDVGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGAC
KKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCN
GPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCAR
AILENYISALNTLWHPECFVCRECFTPFVHGSFFEHEGQPYCEAHYHERRGSLCSGCQKP
ITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcggacctggagtccacaacctctcacatctccaag
cggcctgtgttcttgtctgaggagaccccctactcctacccgactgggaaccacacgtac
caggagatcgccgtgccccccgtcccaccgcccccatccagcgaggccctcaatggcacg
gttctcgaccccttagactcctggccacccagcacctcccgattcacccaccagcagcct
cagtcctcatcccccgtgtacggctccagtgccaagacttccagtgcctccaacccccag
gacggcggcgggctcccgtgtccccgagccggcgaggaagaccacgtgtacagtttcccc
aacaagcagaagtcagcagagccttcacccaccgtcatgagctcctccttgggcagcaac
ctctccgagctcgaccgcctgctgctggagctgaacgccgtgcagcataaccccccgggt
ttccctgcagatgaggccaactccagcccaccgctgccaggggcactgagcacccactac
ggcgtcccagagaataacagcctgctggggggcaaagctggaccactgaccaaagagaag
cccaagcggaacggtggccggggcctggaggacttgcggcccagcgtggagaacctcttg
gatgagctggagagctctgtgcccagtcccgtccccgccatcactgtgaaccagggcgag
atgagcagtccccagcgagtcacctccagccagcagcagacgcgcatctcagcctcctct
gccaccagggagctggacgagctgatggcctcactgtcggattttaagatccagggcctg
gaacagagagcggatggcgagctgcgctgggtggctggctggcctctgaacggcaggcag
agcggccccgaagggcaggacgtgggagggttcatggcccaggggaagacggggagcagc
tctcccccagggggccccccaaagcccggaagccagctggacagcatgctggggagcctg
cagtctgacctgaacaaactgggggtcgccacggtcgccaagggggtctgtggggcctgc
aaaaagccgatcgcggggcaggtggtgacggccatggggaagacgtggcaccccgagcac
ttcgtctgcacccactgccaggaggagatcggctcccggaacttcttcgagcgggatgga
cagccctactgtgaaaaggactatcacaacctcttctctccgcgctgctactactgcaat
gggcccattctggataaagtggtgacagccctcgaccggacgtggcaccccgagcacttc
ttctgtgcccagtgtggagccttcttcgggcctgaagggttccacgagaaagacggcaag
gcctactgccgcaaggattactttgacatgttcgcgcccaagtgtggcggctgcgcccgg
gccatcctggagaactacatctcggccctcaacaccctctggcaccccgagtgctttgtg
tgtcgggagtgcttcacgccgttcgtccacggcagcttcttcgagcacgagggccagccc
tactgtgaggcgcactaccacgagcggcggggctcgctgtgctccggctgccagaagccc
atcacgggccgctgcatcaccgccatggccaagaagttccaccccgagcacttcgtctgc
gccttctgcctcaagcagctcaacaagggcaccttcaaggagcagaacgacaagccttac
tgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system