KEGG   Capra hircus (goat): 102178286
Entry
102178286         CDS       T02910                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
chx  Capra hircus (goat)
Pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102178286 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    102178286 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    102178286 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    102178286 (MAVS)
   05160 Hepatitis C
    102178286 (MAVS)
   05171 Coronavirus disease - COVID-19
    102178286 (MAVS)
   05164 Influenza A
    102178286 (MAVS)
   05162 Measles
    102178286 (MAVS)
   05168 Herpes simplex virus 1 infection
    102178286 (MAVS)
   05169 Epstein-Barr virus infection
    102178286 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 102178286
NCBI-ProteinID: XP_017912880
UniProt: A0A452ERV6
LinkDB
Position
13
AA seq 522 aa
MTFAEDRTYQYIRNNHSNFCNIHVLDILPHLSCLTTSDQDRLRATYERRGNQGTLWDLFD
SLRRRNGWVHTFIRALRICEHNGLADEVARVYQSNLPRNPNHPPAPLEAPPVPAEIPRPS
TRAVAPSIPGNGHTEYEPSYPLPVQDTQLPESLGENSEKAPQPSHSGAVLKRLGGPLEPL
SDTVALSTLTSSVHQEQDTELGSTHTAGVVSSSTSLHGPVSPTVSFQPLARSTPRASRLP
GPPVSAPSVGTSSSSIGLTSAGGAGDQAEGTICSSGAGVPNNPMTASTVPSKVPTNSAFG
SSVPSKLPSLKPPGAMPTSLAPSRLPINSVRSGMVPPKVPTSGKPDHRMPASTVASKVPA
DTRLTIRSSNRLVKETPASPVPTGTATGGTSLWPDSSSDCCGSELELSKPGRLLSRMDSQ
PFSGCSADLAISHSNSLGMGPDNAPEENEYVSEDTIRIHENPSTSLLGDSPGTHTTPKFQ
AEEDGEELPVVRTLPWAPWLGVAMAGALLVLLASLYRRRLPQ
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgacgtttgccgaggacagaacttatcagtatatccgcaacaatcacagcaatttttgc
aatattcatgttctggatattctgcctcacctgtcctgcctcacaacaagtgaccaggac
cgacttcgggccacctatgagcgcagggggaaccagggcaccctctgggacctcttcgac
agtcttcggcggaggaatggctgggtgcataccttcatcagggcactgaggatctgtgag
cataatggtctcgctgatgaagtggcccgtgtctaccagagcaacctgccacggaatcca
aaccaccctccagccccgctggaggcaccaccagttcctgctgagattccaaggccctcc
acacgtgctgtggcccccagcatccctggcaatggccacacagagtacgagccaagttac
cctctgcctgtccaggatacccagctaccagagtccctgggagagaattcagagaaagcc
ccacaaccatcccattctggggctgtcctgaagaggctgggtggccccctggagcccttg
tctgacacggtggccctcagcactctgacctccagtgtacatcaggagcaagacacagaa
ctgggcagtacccacacagcaggcgtggtctccagttccacgtcactccatgggcctgtg
tctccgactgtctccttccagcccttggcccgttctacgcccagggcaagccgcttgcct
ggacccccagtgtcagctccatctgttggcacctcctcctcctccattggcttgacctct
gcaggaggtgctggtgaccaggctgaaggtaccatctgttccagtggggcaggggtgccc
aacaaccctatgactgctagcacagtgccctccaaggtgcccaccaattcagcatttggc
agctcagtgccttccaagttgccaagcttgaagccccctggtgcaatgcccaccagtcta
gcaccatccaggttgcccatcaactcagtgcgttctggcatggtgccacccaaagtgcct
actagtgggaaacctgaccacaggatgcctgcaagcacagtggccagtaaggtgcctgcc
gacacaaggctcaccatcaggagcagcaatagactcgtgaaggagactccagcatcacca
gtgcccacaggcactgccactggaggcacatcactctggccagacagcagctctgactgc
tgtggctcagagctggagctgagcaagcctggaaggctgctatctaggatggacagccag
ccgttctcaggctgctccgcggatctcgccatcagccacagtaactccctgggcatgggg
cctgacaatgcccccgaggagaacgagtatgtgtctgaagacaccattaggatccatgag
aaccccagcacctccctcctgggggacagccccgggacacacactaccccgaaattccag
gcagaggaagacggggaggaattgcctgtggtcaggaccttgccctgggctccgtggctc
ggggtggccatggccggggcacttctagtgctcctggcttcactgtaccggcggcgccta
ccgcagtga

DBGET integrated database retrieval system