KEGG   Capra hircus (goat): 102178319Help
Entry
102178319         CDS       T02910                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
chx  Capra hircus (goat)
Pathway
chx05034  Alcoholism
chx05202  Transcriptional misregulation in cancer
chx05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:chx00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    102178319
  Immune diseases
   05322 Systemic lupus erythematosus
    102178319
  Substance dependence
   05034 Alcoholism
    102178319
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    102178319
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102178319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 102178319
NCBI-ProteinID: XP_017894031
LinkDB All DBs
Position
23
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaactaagcagactgctcggaagtctaccggcggcaaggcaccacgcaagcag
ctcgccaccaaagcggcccgcaagagcgcgccggccaccggcggcgtgaagaagccgcac
cgctaccggcccggcacggtagctctgcgcgagatccgccgttaccagaagtccacggag
ctgctgatccgtaagctgccgttccagcggctggtgcgcgaaatcgcgcaagatttcaag
actgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctat
ctggtggggctcttcgaggacactaacctgtgtgccatccacgccaagcgcgtcaccatc
atgcccaaggacattcagcttgcccgccgcatccgcggagagagggcgtga

DBGET integrated database retrieval system