KEGG   Capra hircus (goat): 102178407
Entry
102178407         CDS       T02910                                 

Gene name
RIPK1
Definition
(RefSeq) receptor interacting serine/threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04210  Apoptosis
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04668  TNF signaling pathway
chx05132  Salmonella infection
chx05160  Hepatitis C
chx05163  Human cytomegalovirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102178407 (RIPK1)
   04668 TNF signaling pathway
    102178407 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102178407 (RIPK1)
   04217 Necroptosis
    102178407 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102178407 (RIPK1)
   04621 NOD-like receptor signaling pathway
    102178407 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    102178407 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    102178407 (RIPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102178407 (RIPK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102178407 (RIPK1)
   05160 Hepatitis C
    102178407 (RIPK1)
   05163 Human cytomegalovirus infection
    102178407 (RIPK1)
   05169 Epstein-Barr virus infection
    102178407 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102178407 (RIPK1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102178407 (RIPK1)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   102178407 (RIPK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Death RHIM Kdo RIO1
Other DBs
NCBI-GeneID: 102178407
NCBI-ProteinID: XP_017894485
UniProt: A0A452G8B6
LinkDB
Position
23
AA seq 667 aa
MSLDDIKMSPKDFLEQADLDSGGFGKVCLCLHRSHGLVILKKVYTGPKRTEYNEALLEEG
RMMHRLRHCRVVKLLGVIMEEGSYSLVMEYMEQGDLMRVLKAQVSIPLSVKGRVIMETIE
GMRYLHGEGVIHKDLKPENILVDSDFHIKIADLGVASFKTWSKLTKEEHNEQRKAGGSAG
KSGGTLHYMAPEHLNDVNSRPSEKSDVFSFAIVLWAIFANKEPYENAICEQQLILCIKSG
NRPDVEDIIEFCPREVIDLMRQCWEVNPDDRPTFAGIEEKFRPFYSNQLENFVEEDVKSL
KKEFPGQNEIVKRMKSLQIDCVAIAPSRSNSATEQPSSLHSSQGFGMGPVEESWFAPAPD
HQPEENDFLLNSKLQEEANYHLYGSRMDRRTKEQPRPNMTHSSEEERRRRVSHDPFAQQR
PYENAQSPGIKGFAYPGVISHTSAAQQPAGLSSQPQSPYWRDASFPLPGLGVRPLDLGTT
SSRVWYAPNPGHMPSLYKTPVPETNLLGNTPTIPFTSVPSRDESAKYTIHNSSGIQIGDS
NYMEIGGMSSSVLDSMYMNLKEEPASKYQAIFDTTTSLTDKHLDPVRENLGRHWKNCARK
LGFSESQIDEIDHDYERDGLKEKVYQMLQKWLMREGSKGATVGKLALALYLCSRIDLVNC
LIRVSQN
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgtccttggacgacattaagatgagccccaaggacttcctggagcaggctgacctggac
agtgggggcttcgggaaggtgtgtctgtgtttacacagatcccacgggctggtgatcctg
aagaaggtgtacacgggccccaagcgcaccgagtacaacgaggccctcctggaggagggc
cggatgatgcaccggctgcggcactgccgcgtggtcaagctgctgggcgtcatcatggag
gagggcagctactcgctggtgatggagtacatggagcagggcgacctcatgcgcgtgctc
aaggcccaggtcagcatccccctgtccgtgaaagggagggtcataatggagaccatcgaa
ggaatgcgctacctgcatggagaaggggtgatacacaaggacctcaagccagagaacatc
ctcgttgacagtgacttccacatcaagatagctgacctcggcgtcgcttccttcaagacg
tggagcaagctgacgaaggaggagcacaacgagcagaggaaggcgggcggcagcgccggg
aagagcggcggcacgctgcactacatggcccccgagcacctgaacgacgtcaactccagg
ccctccgagaagtccgacgtgttcagctttgccatcgtgctctgggcgatcttcgccaac
aaggagccttacgagaacgccatctgtgagcagcagctgatactgtgcatcaagtctggg
aacaggccggacgtggaggacatcattgagttctgcccgcgggaggtcatcgacctcatg
aggcagtgctgggaggtgaacccggacgaccggcccacgttcgcgggcattgaagaaaag
tttaggcctttttattcaaatcaattggaaaattttgtagaagaggatgtgaagagttta
aagaaagagtttccaggccaaaatgaaattgtaaagagaatgaagtctctccaaattgac
tgtgtggcaatagctccaagcaggtcaaattcagccacagaacagcccagttcactgcac
agctcacagggctttgggatgggtcccgtggaggagtcctggtttgctcccgcccccgac
caccagccggaggagaatgacttcctgctaaacagcaaactccaggaggaggccaactac
cacctgtacggcagccgcatggacaggcgtacaaaagagcagcccagaccaaacatgact
cacagcagtgaggaggaaaggaggcgcagggtctcccacgacccttttgcacagcagaga
ccttacgagaatgctcagagcccagggataaaaggcttcgcttaccctggtgtgatcagt
cacaccagtgcagcccagcagccggcagggctaagcagccaaccccagtcaccatactgg
agagatgcatcatttcctctacctgggcttggagtgagaccgctggacctggggaccacg
agttcacgagtttggtatgcgccaaacccaggccacatgccaagcctatataaaactccg
gtgcctgagaccaacctcctggggaacacacccaccattccattcacctctgtgccatca
agagatgagtctgcgaaatataccatacacaacagttctggcattcagatcggcgacagc
aattacatggagattggtggaatgagttcatcagtactcgacagcatgtacatgaacttg
aaagaagagccggcttctaagtaccaagccatctttgatactactactagtctgactgac
aaacacctggacccggtccgggagaatctggggaggcactggaaaaactgcgcccgtaag
ctgggcttttctgaatctcagatcgatgaaatcgaccatgactacgagagagatggactg
aaagaaaaggtttaccagatgctccaaaagtggctgatgcgggaaggcagcaagggggcc
actgtggggaagctggccttggcgctctacctgtgctctcggatagacctggtcaactgc
ctgatccgcgtcagccagaactga

DBGET integrated database retrieval system