KEGG   Capra hircus (goat): 102178465
Entry
102178465         CDS       T02910                                 

Gene name
ZBTB16, PLZF
Definition
(RefSeq) zinc finger and BTB domain containing 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
chx  Capra hircus (goat)
Pathway
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102178465 (ZBTB16)
   05202 Transcriptional misregulation in cancer
    102178465 (ZBTB16)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102178465 (ZBTB16)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    102178465 (ZBTB16)
Ubiquitin system [BR:chx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     102178465 (ZBTB16)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-C2H2_jaz zf-met zf-C2H2_6 zf_UBZ zf-C2H2_2 Endonuclease_7 MIX
Other DBs
NCBI-GeneID: 102178465
NCBI-ProteinID: NP_001301202
UniProt: I6W9Y5
LinkDB
Position
15
AA seq 673 aa
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMAEGGAEEEEDRKARYLKNIFISKHSSEESGYASVAAQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGSLQPPAGPEEPTLAGGGRHPAVAE
VKPEMMQVDEVPGQESPGTAESSISAGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQLPPPVEAGQGPPGRLEPPVPPAEKHLGLYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKAESRTVGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEEALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICSEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggatctgacaaagatgggcatgatccagctgcagaaccctagccaccccacggggctc
ctgtgcaaggccaaccagatgcggctggccgggacgctgtgcgatgtggtcatcatggtg
gacagccaggagttccacgcccaccggactgtgctggcctgcaccagcaagatgtttgag
atcctcttccaccgcaacagccagcactatactctggacttcctgtctcccaagaccttc
cagcagattctggagtatgcatacacggccacgctgcaagccaaggcggaggacctggat
gacctgctgtacgctgccgagatcctggagatcgagtacctggaggagcagtgcctgaag
atcctggagaccatccaggcctcagatgacaacgacacggaggccaccatggcggagggc
ggggccgaggaggaagaggaccgaaaggcgcggtacctgaagaacatcttcatctcgaag
cattccagcgaggagagcggctatgccagtgtggcggcccagagcctccctgggcccatg
gtggaccagagcccttccgtctccacctcatttggcctttcagccatgagtcccaccaag
gcggcagtggacagtctgatgaccataggacagtctctcctgcaggggtctcttcagccg
cccgccgggcccgaggagccgaccctggctgggggtgggaggcaccctgcggtggccgag
gtgaagccggagatgatgcaagtggatgaggtgcccggccaggaaagccctgggaccgcg
gagtctagcatctcagctgggatgggggacaaggtggaagaaaggggcaaggaagggccc
ggaacccctactcggagcagcgtcatcaccagcgccagggagctgcactacggacgtgag
gagagtgctgagcagctgccgcctcccgttgaggccggccaggggccccccggccgactg
gagccccctgtgcccccagctgagaagcacctgggactctactccgtgttgcccaaccat
aaggccgatgctgtgctcagcatgccatcctcggtgacctcgggcctccacgtgcagccc
gccctggctgtctccatggacttcagcacctacgggggtctgctgccccagggcttcatc
cagcgggagctgttcagcaagctgggggagctggctgtgggcatgaaggccgagagccgc
actgtcggggagcagtgcagtgtatgtggcgtggagcttcctgacaacgaggccgtggag
cagcacaggaaactgcacagcgggatgaagacgtacgggtgtgagctctgcggaaagcgg
ttcctggacagtctgcgactgagaatgcacttactggctcactcagcgggtgccaaagcc
tttgtctgcgatcagtgtggtgcccagttctcgaaggaggaagccctggagacgcacagg
cagacccatactggcacagacatggctgtcttctgtctgctgtgcgggaagcgtttccag
gcacagagcgcgctccagcagcacatggaggtccacgcgggcgtgcgcagctacatctgc
agcgagtgcaaccgcaccttccccagccacaccgccctgaaacgccacctgcgctcacac
acaggcgaccacccgtacgagtgtgagttctgtggcagctgcttccgcgacgagagcaca
ctcaagagccacaagcgcatccacacgggcgagaagccctatgagtgcaacggctgcggc
aagaagttcagcctcaagcaccagctggagacgcactatcgggtgcacacaggcgagaag
cccttcgagtgtaagctgtgccaccagcgctcccgggactactcggccatgatcaagcac
ctgcgaacgcacaacggcgcgtcgccttaccagtgcaccatctgcagcgagtactgcccc
agcctgtcctccatgcagaagcacatgaagggccacaagcccgaggagatcccgcccgac
tggaggatagagaagacgtacctctacctgtgctacgtgtga

KEGG   Capra hircus (goat): 102188350
Entry
102188350         CDS       T02910                                 

Gene name
RARA
Definition
(RefSeq) retinoic acid receptor alpha
  KO
K08527  retinoic acid receptor alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04659  Th17 cell differentiation
chx04915  Estrogen signaling pathway
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102188350 (RARA)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102188350 (RARA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188350 (RARA)
   05202 Transcriptional misregulation in cancer
    102188350 (RARA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102188350 (RARA)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    102188350 (RARA)
Nuclear receptors [BR:chx03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   102188350 (RARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 102188350
NCBI-ProteinID: XP_017920520
UniProt: A0A452EMU9
LinkDB
Position
19
AA seq 462 aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQAGSGGRDGGGLAAPPGSCSPSLSPSSNRSSPATHSP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccagcaacagcagctcctgcccaacacctgggggagggcacctcaatgggtacccg
gtgcccccctacgccttcttcttcccccccatgctgggtggactctcccccccaggcgct
ctgaccactctccagcaccagcttccagtgagcggctatagcacgccatccccagccacc
atcgagacccagagcagcagttccgaagagatcgtgcccagccccccctcgccgcctcct
ctcccccgcatctacaagccttgctttgtctgtcaagacaaatcctcaggctaccactat
ggggtcagcgcctgtgagggttgcaagggcttcttccgccgcagcatccagaagaacatg
gtgtacacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgttgc
cagtactgtcggctgcagaagtgcttcgaagtgggcatgtccaaggagtccgtgagaaat
gaccggaacaagaagaagaaggaggtgcccaagcccgagtgctccgagagctacacgttg
acaccagaggtgggggagctcatcgagaaggtgcgcaaagcgcatcaggagaccttccct
gcgctctgccaactgggcaaatacactacgaacaacagctcagaacagcgtgtctccctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcaactgcccggcttcaccaccctcaccattgcggaccagatcaccctc
ctcaaggctgcctgcctggacatcctgatcctgcggatctgcacgcggtacacgcccgag
caggacacgatgaccttctcggacgggctgaccctgaaccggacccagatgcacaacgcc
ggctttggcccactcacggacctggtcttcgccttcgccaaccagctgctgcccctggag
atggatgacgctgagactgggttgctcagcgccatctgcctcatctgtggagaccggcag
gacctggagcagccagacagggtggacatgctgcaggagccgctgcttgaggcactgaag
gtctatgtgcggaaacggaggcccagccgcccacacatgttccccaagatgctgatgaag
atcacagacctccggagcatcagtgctaagggggctgagcgagtgatcacgctgaagatg
gagattccgggctccatgccacctctcatccaggaaatgctggagaactcagagggtctg
gacactctgagcggacaagcggggagtggggggcgggatgggggcggcctggctgccccg
cccggcagctgtagccccagcctcagccccagctcaaacagaagcagcccggccacccac
tccccgtga

DBGET integrated database retrieval system