KEGG   Capra hircus (goat): 102178527
Entry
102178527         CDS       T02910                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04630  JAK-STAT signaling pathway
chx04640  Hematopoietic cell lineage
chx05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102178527 (IL3RA)
   04151 PI3K-Akt signaling pathway
    102178527 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102178527 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102178527 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102178527 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102178527 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:chx04050]
    102178527 (IL3RA)
   04090 CD molecules [BR:chx04090]
    102178527 (IL3RA)
Cytokine receptors [BR:chx04050]
 Interleukin receptor families
  IL3 receptor family
   102178527 (IL3RA)
CD molecules [BR:chx04090]
 Proteins
  102178527 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 102178527
NCBI-ProteinID: XP_017900045
LinkDB
Position
Un
AA seq 419 aa
MALPGLAVLLILICCSMTTDHAISDPDPPIKNLRIDPERKRLVWDQHGNVSEIGCYVNSK
ILRKATKNPYCTLGDLSCEVKNYTVKVMKGQPFSDWILYPKQGNPRAAADNLTCRVHDVD
QLSCSWAVGEEAPADVQYQFYLKQSVETWQCPKYTQNQQGVNVQCHFDSISLQPQRQAQF
RFLVNGTSGDSEIPCRVMIHRLQEIEILAAPNITKKWCNENDSFMEWEVRSLFTEDIKYE
LEIQKGTDLAYKEETELKSLRLRNPGPYTVKVKAMDSLFFGRRPPGQWSAPQHLDCGGKN
ASFPFWLVYLLAPLGALLLVGLVFLCRRWPVVQKLFPRVPHVKDPVGDSFQNERMVGDGL
GPRAGEPGGVSGGPGAGVGGSMNLMQPGASFFRPGGGRAAGPGWARSFAAVEDGKAWRT
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggccctccccgggctggccgtgctcctgatactcatctgctgctcgatgaccacggac
cacgccatctctgatccagacccaccgattaagaacttaaggatagatccagaaagaaaa
agattggtctgggaccagcacggaaatgtttctgaaattgggtgttacgtcaattcgaaa
attttaagaaaggcaacaaagaacccctattgcactcttggcgacttgtcatgcgaagtg
aaaaactacaccgtgaaggtgatgaaaggtcaaccgttctctgactggattctgtatcca
aaacaaggcaacccccgggcggccgcggacaacctgacctgccgggtgcacgacgtggat
cagctcagctgcagctgggcggtgggcgaggaggccccggcggacgtgcaataccaattc
tacctgaagcagtccgtggagacgtggcagtgtcccaagtacacgcagaaccagcagggc
gtcaacgtccagtgccattttgacagcatctcccttcaacctcaacgccaagctcagttt
cgtttcctggtgaatggtaccagcggtgactccgaaatcccctgccgcgtaatgattcat
agattgcaagaaattgaaatattagctgccccgaacatcacaaaaaagtggtgtaacgaa
aacgactctttcatggaatgggaagtaaggagtctctttactgaagacatcaagtatgag
cttgagatacagaagggcacggacctcgcctacaaagaggagacggagctcaagtccttg
aggctgaggaacccgggaccctacacggtgaaggtcaaggccatggactccctgttcttc
gggagaagaccgccgggccagtggagcgccccgcagcacctcgactgtggcggcaagaac
gcgtccttcccgttctggctggtgtacctgctggccccgctcggggcgctgctcctggtg
gggctcgtgttcctctgtcgcaggtggccggtggtgcagaagctcttcccgcgtgtccct
cacgtgaaagacccggtcggcgacagctttcagaacgagaggatggtaggcgatggcctg
ggaccccgagcaggagagccaggaggagtgtccggtggtccaggtgcaggtgttggggga
agcatgaatctgatgcaaccgggggcttcgtttttccgcccgggaggaggacgcgcagcc
gggcccggttgggcgcggtcgtttgctgcagttgaggatggcaaggcctggcgcacctga

DBGET integrated database retrieval system