KEGG   Capra hircus (goat): 102178971
Entry
102178971         CDS       T02910                                 

Gene name
PER2
Definition
(RefSeq) period circadian clock 2
  KO
K02633  period circadian protein 2
Organism
chx  Capra hircus (goat)
Pathway
chx04710  Circadian rhythm
chx04713  Circadian entrainment
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    102178971 (PER2)
   04713 Circadian entrainment
    102178971 (PER2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102178971 (PER2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102178971 (PER2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:chx03400]
    102178971 (PER2)
DNA repair and recombination proteins [BR:chx03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102178971 (PER2)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 102178971
NCBI-ProteinID: XP_017895686
LinkDB
Position
3
AA seq 1291 aa
MDGCADHTPSPSGPSEEPTEPRASQATLLEDVDMSSGSSGNETSENGSTGRDSRHSGCGD
SGREPGLLLGPPSARQGPGTFGLMMAKSEHHLSTSGCSSEQSTKADAHRELIKTLKELKV
HLPADRKPKGKASTLATLKYALRSVKQVKASEEYYQLLMSSENHPCSTHVPSFTVHEIEG
ITSEFIMKNVDMFVAAVSLVTGKILYISDQVASIFRCKRDAFYNAKFVEFLAPHDVSVFH
SSTTPYKLPPWSDRRQADSFTQECMEEKSFFCRVSVGKNHESEIRYHPFRMTPYLAQVCE
HQGAESQLCCVLLAERVHSGYEAPRIPPEKRIFTTTHSPNCLFQDVDQRAVPLLGHLPQD
LIETPVLVQLHPSDRPLMLAIHKKIVQSGGQPFDYSPLRFRARNGEYVTLDTSWSSFINP
WSRKISFIIGRHRVRLGPLNEDVFSAPPGLEEKAPQPGVQELTEQIHRLLLQPVPHSGSS
GYGSLGSNGSHEHLMSQTSSSDSAGQEDPRRKRAEICKNGNKAKSKSHYPDESGEQKSKP
ASEMQSGSPTPMKAAAAAEKDSSGASLPEASPPEGLACRDPPAASYQQISCLDGVIRYLE
SCSEAATLKRKCEFPASLPTPQASDKRLALAGPGPHAAEAAAPSPVKSRTDVGARLTSLT
LPGKAESMASLSSQCSYSSTIVHVGDKKPLPELELLGDAAASGPESLECLAGPALPCGLS
QDQEAFWKLGLTKEVLAAHTQKEEQSFLLRFREIRKLHVFQSRCHHYLQERPKGHLSNRT
APRLRNTSGIDSSWKKNGKNRKLKSKRVKPRDSSGSTGSGGLAPQRPPLVGLNTTAWSLS
DTSQSSCPAVPFPDPVPAYSLPLFPAPGTVPAPGTVATGSGAAHTNLAVPMDAHQALRAH
PPPFASPVAPVVALVLPGYSFSPVTPTLPAAFFPDQRNFASEMPPASQPDFFPDRTSAPK
QPCTYAPAERGQSASRVATPGTPPLAAGLPDRTSPALFQSRGSSPLQLNLMQLEEAPEGT
AAATGAVGTMGAAANCKPGSSWDWQPQSPPTRAEPADAPNSDALSSSSGFLHLLLHGDLC
SATGSALSGSQASATSCSLGSGSLGCDASRSGPGSSDASHTSRYFGSVDSSEKNHGAAAK
AEVGGTERLLRGVLQDPVWLLMADTDDSVRMTYQMPARNLETVLQEDREKLKALQRFQPR
FTDGQKQELQDVHPWMRLGGVPAAIDVAGCVYCENEGEDNLCVSYEEDISTPGLSEVTET
KEGESGPARGRETSGRHSAPPQGGRAASDVR
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggacggctgcgccgaccacacgcccagccccagcggcccctccgaggagcccacggag
ccccgggccagccaagccaccctcctggaggacgtggacatgagcagtggctcaagcggg
aacgagaccagtgagaacggctcgacggggcgggactcgcggcacagcggctgtggagac
agcggccgggagccggggctgctgctggggccgccgagcgcccgccagggtccaggaacc
tttggcctgatgatggcgaagtctgaacaccacctgtccaccagcggctgcagcagcgag
cagtccaccaaagccgacgcccacagagagctcatcaaaaccctgaaggagctgaaggtc
cacctccccgcggacaggaagcccaaggggaaggccagcaccttggcgacccttaagtac
gccctgaggagcgtgaagcaagtgaaagccagtgaggagtactaccagctgctgatgtcc
agtgagaaccacccttgcagcacccacgtgccctccttcaccgtgcacgagatcgagggc
atcacctccgagttcatcatgaagaatgtggatatgtttgtggccgctgtgtccctggtg
acggggaagattctgtacatctctgaccaagtggcctccatctttcgctgtaagagggat
gccttctacaacgccaagtttgtggagttcttggcgccccatgacgtgagcgtgttccac
agctccaccacaccgtacaagctgccgccctggagtgaccgccgccaagcagactctttt
actcaagaatgtatggaggagaagtctttcttctgccgagtcagtgtcggcaaaaaccat
gagagcgagatccgctaccatccgttccgcatgacgccctacctggcccaggtgtgcgag
catcagggcgcggagagccagctttgctgcgtgctgctggcggagagagtgcactcgggc
tatgaagcccctagaatccctcctgaaaagagaatttttacgaccacacattcgccaaat
tgtctgttccaggacgtggaccaaagggccgtccctcttctgggccacctgccccaggac
ctgatcgagacccccgtgctcgtgcagctgcaccccagcgacaggcccctgatgctcgcc
atccacaagaagatcgtgcagtctggggggcagcccttcgactactccccgctccggttc
cgcgcccgaaatggggagtacgtcacactggacaccagctggtccagcttcatcaacccc
tggagcagaaagatctccttcatcattgggagacacagagtgaggctggggcctctgaac
gaggacgtgttctctgccccgcccggcctggaggaaaaggccccacagcccggcgtccag
gagctcacggagcagatccaccggctgctgctgcagcccgtgccccacagcggctccagc
ggctacgggagcctgggcagcaacgggtcccacgagcatctcatgagccagacctcctcc
agcgacagtgccggccaggaggacccccgccggaagagagccgaaatttgtaaaaatggt
aacaaggccaaaagcaaaagtcattaccctgatgaatctggagaacaaaagagcaagcca
gcttcagaaatgcagagcggttccccgactccgatgaaagctgctgcggctgcggagaag
gacagctccggggccagcctgcccgaggccagccctcccgaggggctggcctgcagggac
ccgccggccgcttcctaccagcagatcagctgcctggacggcgtcatcaggtacctggag
agctgcagcgaggcggccaccctgaagaggaagtgcgagttccctgcgagccttcccaca
ccccaggccagcgacaagcgcctggccctcgcgggccccgggccacacgccgcagaggca
gcagcgccctccccagtgaagagccgcacggacgtgggcgcacggctgacgtcgctgacg
ctgcccggcaaggcggagagcatggcgtccctcagcagccagtgcagctacagcagcacc
atcgtccacgtgggcgacaagaagccgctgccagagctcgagctgctgggagatgctgct
gcgagcgggcccgagtctctggagtgcctggcaggccctgcgctgccctgcggcctcagc
caggaccaggaggccttctggaagctgggcctcaccaaggaggtgctggccgcccacacc
cagaaggaggagcagagcttcctgctgcggttccgggaaatcaggaaactccacgttttc
cagtctcgctgccatcattatctgcaagaaaggcccaaggggcacttgagcaacaggact
gctcccagactaagaaatacctctggaatagactcctcttggaaaaaaaacgggaaaaac
cgaaaactgaagtccaaacgtgtcaagcctcgcgactcctcgggcagcactgggtctggg
gggctggcgccccagcggcccccactggtcggcctgaacaccacggcctggtccctgtcg
gacacgtcacagtccagctgcccagcggtccccttccctgacccagtgccagcgtactcc
ctgcccttgtttccagccccaggaacagtgcccgcaccagggaccgtggccacaggatcc
ggggctgcccacaccaaccttgcggtgcccatggatgcccaccaggcgctcagggcccat
cccccgccgttcgccagccccgtggccccagtcgtggcattggtcttgcctggctactcc
ttctccccggtgaccccaaccctgcccgcagccttcttccccgaccagcggaactttgca
tctgagatgcctcctgcctcacagcccgacttcttccctgatcggacctcagcccccaaa
cagccgtgcacatatgccccagcagagcgagggcagtccgcgtcgcgggtggccaccccg
ggaaccccgcccttggccgccgggctcccagacaggacctccccggcactcttccagtcc
cgcggaagctcaccactgcagctcaacctgatgcagctggaggaggcccctgagggcacc
gcggcagccacaggggctgtgggaaccatgggtgcagccgccaactgcaaacctggctcg
tcctgggactggcagccccagtcacctccaacccgtgcggagccggcggatgccccgaac
agcgacgccctgtcctcgtccagcggcttcctccacctgctgctacacggggacctctgc
tcggccacaggctctgcactgtccgggagtcaggcctccgccacctcctgctccctgggc
tcgggctccctgggctgcgatgcgtccagaagcgggccaggcagcagcgacgcgagccac
accagcaggtatttcggaagcgtcgactcttcggagaaaaaccatggcgcagcggcgaag
gcagaggtgggcgggactgagcgcctgctcaggggtgtcctccaggaccccgtctggctg
ctgatggccgacacggacgacagcgtcaggatgacctaccagatgcctgcacgaaacctg
gagacggtcctgcaggaggacagggagaagctgaaggcactgcagaggttccagcccagg
ttcacggacgggcagaagcaggaactgcaggacgtccacccgtggatgcggttgggcggc
gtgcccgcggccatcgacgtggcgggatgtgtttactgtgaaaacgagggagaagataac
ctctgtgtgtcatacgaggaagacatctctacgccggggctcagcgaagtgacagagacc
aaggaaggggagagtgggcccgcccgcggccgggaaacgagcggcaggcacagcgcccct
ccccagggcggccgcgccgccagcgacgtccgctag

DBGET integrated database retrieval system