KEGG   Capra hircus (goat): 102179035
Entry
102179035         CDS       T02910                                 

Gene name
CYLD
Definition
(RefSeq) CYLD lysine 63 deubiquitinase
  KO
K08601  ubiquitin carboxyl-terminal hydrolase CYLD [EC:3.4.19.12]
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102179035 (CYLD)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102179035 (CYLD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102179035 (CYLD)
   04625 C-type lectin receptor signaling pathway
    102179035 (CYLD)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102179035 (CYLD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chx01002]
    102179035 (CYLD)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:chx04121]
    102179035 (CYLD)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102179035 (CYLD)
Peptidases and inhibitors [BR:chx01002]
 Cysteine peptidases
  Family C67
   102179035 (CYLD)
Ubiquitin system [BR:chx04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    102179035 (CYLD)
SSDB
Motif
Pfam: CYLD_phos_site CAP_GLY UCH COX_ARM
Other DBs
NCBI-GeneID: 102179035
NCBI-ProteinID: XP_013826480
UniProt: A0A452G7G4
LinkDB
Position
18
AA seq 953 aa
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGLSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTGLESDYAGPVDTMQVELPPLEINSRVSLKL
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPESVTQERRPPKLAFMSRGVGDKGSFSHNKPKATGSTSDPGTRNRSELFYTLNGSSV
DSQPQSKSKNSWYIDEVAEDPAKSLTEIPPDFGHASPPLQPPSMNSLSSENRFHSLPFSL
TKMPNTNGSISHSPLSLSVQSVMGELNNAPVQESPPLAVSSGNSHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNE
KVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLED
TPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNAQVHLHPKRLNHKYNPVSLPKD
LPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNI
PQVTPCPEVGEYLKMSLDDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgagttcgggcttatggagccaagaaaaagttacttcaccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacacaaaaactccttaaa
gtaccaaagggaagcataggacagtatatccaagaccgttctgtggggctctcaaggatt
ccttctgccaaaggcaagaaaaatcagattggattaaaaattctagagcaaccacatgca
gttctgtttgttgatgaaaaggatgttgtagaaataaatgagaaattcacagagttactt
ttggcaattaccaattgtgaagagaggttcagcttgtttaaaaacagaaacagactaagt
aaaggcctccaaatagatgtgggctgccctgtgaaagtccagctgagatctggggaagaa
aaatttcctggagttgtgcgcttcagaggacctttattagcagagaggacagtatcggga
atattctttggagtagaattactggaagaaggtcgtggccaaggtttcactgatggggta
tatcaagggaagcagctttttcagtgtgatgaagattgtggagtatttgttgcgttggac
aagctagaactcatagaagatgatgacactggattggaaagtgattatgcaggtccagtg
gatacaatgcaagttgaactaccccccctggaaataaactccagagtttctttgaagctt
ggagaaactatagaatctggaacggttatattctgtgatgttttgccaggcaaagaaagc
ttaggatattttgttggtgtggacatggataatcctattggcaactgggatggaagattt
gatggagtgcagctttgtagttttgcaagtgttgaaagtacaattctcttgcatatcaat
gacatcatcccagagagtgtaacacaggaaaggaggcctcccaaacttgcatttatgtca
agaggtgttggggacaaaggttcattcagtcataataaaccaaaggctacaggatctacc
tcagaccctggaactagaaacagatctgaattattttataccttaaatgggtcttctgtt
gactcacaaccacaatccaaatcaaaaaattcatggtacattgatgaagttgctgaagac
cctgcaaaatcgcttacagagattcctccagactttggacacgcttcaccaccactgcaa
cctccttccatgaactcactctccagcgagaacagatttcattctttaccatttagtctg
acaaagatgcctaacaccaatggaagtattagccacagtccactctctctgtcagttcaa
tctgtgatgggtgagctgaacaatgcccctgtgcaggagagtccacccttggccgtatct
tctggtaactcgcatggcctggaagtgggctcgctggctgaggtcaaggagaatcctcct
ttctatggggtaatccgctggattggtcagccaccaggcctcaatgaagtactagctgga
ctggaactggaagatgaatgtgcgggttgtacagatggaacattcaggggcactcgctat
ttcacctgtgcccttaagaaggcgctgtttgttaaactgaagagctgcagacccgactcg
aggtttgcgtccctgcagccagtttccaatcagatcgaacgctgtaattctttagcattt
ggagggtacttaagtgaggtagtagaagaaaatactccaccaaaaatggaaaaagaaggt
ttagagataatgattggaaagaagaaaggtatccagggtcattacaattcttgttactta
gactccaccttattctgcttatttgcttttagttccgttctggatactgtgttacttaga
cctaaagaaaagaatgacgtagaatactatagtgaaactcaagaactcctgaggacagaa
atcgttaatcctctgagaatatatggatatgtatgtgcaacaaagattatgaaactgagg
aagatacttgaaaaagttgaggctgcatcaggatttacctctgaagaaaaagatcctgaa
gaattcctgaatatcctgtttcatcatattttaagagtagaaccattgttaaaaatcaga
tcagcaggtcaaaaagtacaagattgttacttctatcaaatttttatggaaaaaaatgag
aaagttggagttcctacaattcagcagttattagaatggtcttttatcaacagtaacctg
aaatttgctgaggcaccatcatgtctgattattcagatgcctcgatttggaaaagacttt
aaactatttaaaaaaatttttccttctctggaactaaatataacagatttacttgaagac
acccccaggcagtgccggatatgtggagggcttgcgatgtatgagtgtagagaatgctat
gatgaccctgacatctcagctggcaaaatcaaacagttttgtaaaacctgcaatgctcaa
gtccaccttcatcccaagaggctgaatcataaatacaacccagtgtcacttcccaaagat
ctgcctgactgggactggagacacggctgcatcccctgccagaagatggagttattcgct
gtcctctgcatagaaacaagccactatgtcgcttttgtgaagtacgggaaagacgactct
gcctggctattcttcgacagcatggctgatcgggatggtggtcagaatggcttcaacatt
cctcaagttaccccatgcccagaagtaggagagtacttgaaaatgtctctcgatgatctg
cattccttggactccagaagaatccaaggctgtgcacgaagacttctctgtgatgcatac
atgtgcatgtaccagagtccaaccatgagtctgtacaaataa

DBGET integrated database retrieval system