KEGG   Capra hircus (goat): 102179067Help
Entry
102179067         CDS       T02910                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
chx  Capra hircus (goat)
Pathway
chx00052  Galactose metabolism
chx00500  Starch and sucrose metabolism
chx01100  Metabolic pathways
chx04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102179067 (MGAM)
   00500 Starch and sucrose metabolism
    102179067 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102179067 (MGAM)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102179067 (MGAM)
    3.2.1.20  alpha-glucosidase
     102179067 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102179067
NCBI-ProteinID: XP_017902340
LinkDB All DBs
Position
4
AA seq 1832 aa AA seqDB search
MARKKLKKFTTLELMLSILLLVVFIITIPIFVLSARDSLESQDPGTTVSPDPGTSTTPGS
AECPVVNDSERINCIPDQSPTKATCDQRGCCWSPQGTISKPWCYYSKSHGYQVGGDLMNT
NAGFTAQLERLSSPSLFGNDVNNVLLTAEYQTSNRFHFKLTDQNQNRYEVPHEHVQPFTG
NAASSLTYKVEVSKQPFGIKVIRTSNNRVLFDSSVGPLLFAHQFLQLSIRLPSANVYGLG
EHVHQQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLLNSNAM
EVFLQPTPAITYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPALPSYWALGFHLSRYDY
GTLENMKEVVERNRAAQLPYDVQHADIDYMDARKDFTYDPVAFKGFPEFVKELHNNGQKL
VVIVDPAISNNSSLSNPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGKTVFPDYTNPKCT
AWWTNEFELFHSQVEFDGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPKILDGYLFSKS
ICMDAVQHWGRQYDVHNLYGYSMAIATAETVKTVFPNKRSLILTRSTFAGSGKFAAHWLG
DNAASWNDLRWSIPGILEFNLFGIPMVGADICGFLLDTSEELCRRWMQLGAFYPFSRNHN
GQGYKAQDPASFGTDSLLLNSSRHYLTIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYQ
DSNTWDVHQQFLWGPGLLITPVLDEGAEKVTAYMPDAVWYDYETGVQERWRKQKVEMELP
GDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDENKEAKGELFWDDGETKDTVAN
NLYLLCEFSVTQNRLEVKILQSTYTDPNNLAFKEIKILGTQELNNVAVKQNGVPIQVSPN
VTYDSNLQVALITGIDLVLGETYTVEWDVKIRDEEKIDCYPDQTGVSAENCTARGCAWEG
SSSPGVPLCYFVSDLYSVSDVQYDSHGASAVISLKTSLYAYSFPSVPVNSLRLTVTYHKD
YMLQFKIYDPNNNRYEVPVPLNIPNVPSGTPESQLYAVLIKENPFGIEIRRKSTGTVIWD
SQLLGFTFNDMFIRISTRLPSRYLYGFGETEHTAFRRDLGWNTWGMFSRDQPPGYKKNSY
GVHPYYMAMEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVVLGPTPELVTQ
QYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDAMVAAQIPYDVQYSDIDYMERQL
DFTLDAEFEGFPALITRMQADGMRVIIILDPAISGNETKPYLPFTRGVEDDVFIKDPSDG
SIVWGKVWPDFPDVVINSSLDWDSQVEKYRAFVAFPDFFRNSTIAWWKRELKELYTNPRE
PEKSLKFDGLWIDMNEPASFVNGAVLPGCKNATLNNPPYMPHLESRDLGLSSKTLCMESQ
QVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDN
TAAWDQLQKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFARNHNTI
GTRRQDPVSWNSTFVTISKSVLETRYALLPYFYTLMHKASTEGSTVVRPLLHEFVSDRVT
WTIDSQFLLGPAFLVSPVLEANARDVTAYFPKARWYDYYTGVDIQSTGEWKSLPAPLDHI
NLHVRGGYVLPWQEPAQNTHLSRQKFFGFKVALDDEGTAEGWLFWDDGQSIDTYEKGQYY
LAHFSVSQNTMQSHIIFNKYISDTNPLRLGYFEVWGVGSDSISSVSISVSGVVITPTFSY
NSTTQVLNIDVTSRNISLHNFTSLTWRSTLNF
NT seq 5499 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaagttcactactttggagcttatgctcagtattcttctg
cttgtggtgtttatcatcactattcccatcttcgtgctttcagccagagattccctggaa
tcacaagatcctgggacgacagttagcccagatcctgggacaagtaccacccctggttct
gccgagtgcccagtggtaaatgactcggaacggataaactgcatccctgaccaatcacca
acaaaggctacctgtgaccagcgtggctgttgctggagtcctcagggaaccataagtaag
ccctggtgctactattctaagagtcatggctatcaagtagggggcgacctcatgaacaca
aatgcaggattcacagcccagctggaaaggttgtcttctccatctctgtttggaaatgat
gtcaacaatgtccttctcacagcagaataccagacatctaaccgtttccactttaagtta
actgaccaaaaccagaacagatatgaagtaccccatgaacacgtgcaacccttcacagga
aatgctgcctcttccttgacgtataaagttgaggtctccaaacagccgtttggcatcaaa
gtgatcagaacgagcaacaatcgtgttctgtttgactccagcgttgggcccctgctgttt
gctcaccagttcctgcagctctccatccgactgcctagtgccaatgtgtatgggctggga
gaacacgtgcaccagcagtaccggcatgacatgaactggaagacctggcccatatttgcc
agggacaccacccccaatggggatggaactaacttgtatggtgcacagacattcttccta
tgccttgaagatgctagtggattgtcctttggagtgtttctgctgaacagcaatgccatg
gaggttttcctccagcccaccccagctatcacttaccgcaccatcgggggcattcttgac
ttttacgtgttcttggggaatactccagagcaagttgttcaagaatacctagagcttgtt
ggacggccagccctaccctcatactgggcgcttgggtttcatctcagtcgttatgactat
ggaaccctagagaacatgaaagaagtcgtggagagaaaccgtgctgcacagctgccttat
gatgttcagcacgctgatattgattacatggatgcaagaaaggacttcacttatgatcca
gtagctttcaagggcttccctgagtttgttaaagaattacacaataacggacagaaactg
gtcgtcattgtggatcctgccatctccaacaactcttccctaagtaatccctatggcccg
tatgacaggggttcagatatgaagatatgggtgaattcttcagatggagtgactccactc
attggggaggtctggcctggaaaaactgtgtttcctgattacaccaaccctaagtgtact
gcttggtggacaaatgaatttgagcttttccacagtcaagtagagtttgatggaatctgg
attgatatgaatgaagtcgccaacttcgtggatggctcagtttcaggatgttccacgagc
aatctaaattatcccccattcactcccaaaatcctggatgggtacctgttcagcaagagc
atctgcatggacgcagtgcagcactgggggcggcagtatgacgtccacaacctgtacggc
tactccatggccatcgccactgcagaaactgtcaagactgtgttccccaacaagagaagc
ctcattttaacccgttctacatttgcgggttctggcaagtttgcagcccactggttggga
gacaatgcagcctcctggaacgacctccgatggtccatccctggcatacttgagttcaac
ctttttggtatcccaatggtgggtgctgacatatgtggctttctactggacacttctgaa
gagctctgcagacggtggatgcagctgggagcattctatccattttccaggaatcacaat
ggccaaggctacaaggcccaggatccagcctcctttggcaccgactcgctgctgttgaat
tcctccaggcactacctgaccatccgctatacccttctgccctatctctacaccctcttc
taccgtgctcacagccgcggggataccgtggccaggccccttctgcatgagttctaccag
gacagcaacacctgggatgtgcaccagcagtttttatgggggcccggcctcctcatcact
ccagtcctggatgagggtgcagagaaagtgaccgcatacatgcctgacgctgtctggtat
gactatgagactggggtccaagagagatggaggaagcaaaaagtggagatggaacttcct
ggagacaaaattggacttcacctgcgaggaggctacatcttccccacgcagcagccagcc
acgaccacagtggccagtcgacggaaccctcttggtctaatcattgccctggatgagaac
aaagaagcaaaaggcgaacttttctgggatgatggggaaacaaaagatactgtggccaac
aacctttatctcttatgtgagttctccgtcacccaaaaccgcctggaggttaagattttg
cagtcaacctacacagaccccaataatttagcatttaaagaaattaaaatccttggaacc
caggagcttaacaacgttgcagtgaaacagaacggtgttccaattcaagtttctcctaat
gtcacttacgattctaacctacaggtggcccttatcacaggaattgatcttgttctggga
gaaacatacacggtggagtgggatgtgaagatacgagatgaagaaaaaatagactgttat
cctgatcagactggtgtttctgcagaaaactgcactgcccgcggttgtgcctgggaggga
tccagttcccctggagtccctttatgctatttcgtcagtgacctctactctgtcagtgat
gttcagtatgactcacacggggcctcagctgtcatctccttaaagacttctctgtatgcc
tactccttcccctcagtacctgtgaactccctccgcctgactgtgacctaccataaggat
tacatgctgcagtttaagatttatgatcccaacaacaaccgctatgaagttccagtccct
ctcaacatacccaacgttccatctggcacccctgagagtcaactctatgctgtcctcatc
aaggagaatccatttgggattgaaattcgccgcaagagtacaggcactgtcatctgggac
tctcagctcctcggcttcaccttcaatgacatgttcatccgcatctccacgcgcctcccc
tcccggtacctctacggctttggggaaactgagcacacagccttccgaagagacttggga
tggaacacgtgggggatgttctcccgagaccaacccccggggtacaagaagaactcctac
ggtgtccacccctactacatggcaatggaggaggatggcagtgcccatggagtgctcctg
ctgaacagcaatgccatggatgtgaccttccagcccttgcctgccttgacataccgtacc
acaggaggaattctggacttttatgtggttttagggccaactccagagcttgtcactcag
cagtacactgagttgattggtcggccggtgatggttccttactggtccctggggtttcag
ctgtgtcgctatggataccagaacgactctgagattgccagcttgtacgatgcgatggtg
gctgcacagatcccctatgatgtgcagtactcggacattgactacatggagcggcagctg
gacttcacccttgatgccgagtttgaggggtttccagctctgattactcgcatgcaggcc
gatgggatgcgagtcattatcattctggacccagccatttctggcaacgagaccaagccc
tatctgccattcacacggggtgtagaggatgatgtcttcatcaaagatccgagtgatggg
agcattgtctggggaaaggtctggcctgattttcctgatgtggtaataaacagttctcta
gactgggacagtcaagtggagaaataccgggcatttgtggcctttccagactttttccgt
aattcaaccatcgcatggtggaagagggagttgaaagaactgtacaccaatccgcgggag
ccagagaagagcttgaagttcgatggcttgtggattgatatgaatgaaccagcgagcttc
gtgaatggagcagtccttccaggctgcaagaatgccactctgaacaaccctccctatatg
ccacatctggagtccagggacctgggcctgagcagcaagaccctgtgcatggagagccag
caggtcctgcctgacggctcaccggtgcgccactacgacgtgcacagcctctatgggtgg
gcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgagggatcgtc
atcactcgctccactttcccctcttctggccgctggggaggacactggctgggagacaac
acggccgcgtgggaccagctgcagaagtcaatcattggcatgatggagtttagtctcttt
ggtatatcctacacaggagcagatatttgtggattctttcaagatgctgaatatgaaatg
tgtgctcgctggatgcaactaggggccttctaccccttcgcaaggaatcacaataccatt
gggaccaggaggcaagaccccgtgtcctggaattctaccttcgtgacaatctccaagagt
gtcctggagaccagatacgccctgttgccgtatttctacaccctgatgcacaaggccagc
acagagggcagcaccgtcgtgcggcctctccttcatgagtttgtgtcagaccgggtgacc
tggactatagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggag
gctaacgctagagatgtcactgcatatttccccaaagcccgctggtatgattactatacg
ggtgtggacattcagtcgacgggtgagtggaagtccttgccagcgcctcttgaccacatt
aatcttcatgtccgtgggggctacgtcctgccctggcaagagcctgcacagaacacccac
ttaagccgtcagaaattcttcggtttcaaggtcgccttggatgatgaggggaccgctgaa
ggctggctcttctgggatgatgggcaaagcattgatacctatgaaaaaggacaatattac
ctggcccacttttcagtcagccagaataccatgcagagtcatataattttcaacaaatac
atcagtgatacaaaccctttgagactgggctactttgaggtctggggagtgggcagtgac
tccatctccagtgtcagcatctctgtgagtggcgtggttataacacccaccttctcctac
aactctacaacacaggtgttaaatattgatgtgaccagcagaaacatcagcctacataat
ttcacttcattgacatggagaagcacactgaatttttag

DBGET integrated database retrieval system