KEGG   Capra hircus (goat): 102179249
Entry
102179249         CDS       T02910                                 

Gene name
SLC9A1
Definition
(RefSeq) solute carrier family 9 member A1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
chx  Capra hircus (goat)
Pathway
chx04024  cAMP signaling pathway
chx04260  Cardiac muscle contraction
chx04261  Adrenergic signaling in cardiomyocytes
chx04371  Apelin signaling pathway
chx04810  Regulation of actin cytoskeleton
chx04919  Thyroid hormone signaling pathway
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102179249 (SLC9A1)
   04024 cAMP signaling pathway
    102179249 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102179249 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102179249 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102179249 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    102179249 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    102179249 (SLC9A1)
   04971 Gastric acid secretion
    102179249 (SLC9A1)
   04972 Pancreatic secretion
    102179249 (SLC9A1)
   04976 Bile secretion
    102179249 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102179249 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102179249 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chx02000]
    102179249 (SLC9A1)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102179249 (SLC9A1)
Transporters [BR:chx02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   102179249 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 102179249
NCBI-ProteinID: XP_017912116
UniProt: A0A452FVM0
LinkDB
Position
2
AA seq 818 aa
MLLWSGASGLPPPRIFPSLLVVVALVGLLPVLRSHGLQPSPTASTIRGSEPPRERSIGDV
TTAPPELAPESRPVNHSFAEHSPKARKAFPVLGIDYQHVRTPFEIALWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPILQSEVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLENLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDRVGIVDIILGFLSFFV
VSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPAERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKISNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITID
PASPQSPESVDLVNEELKGKVLGLSRDPGRLAEEEEDDEDPDGGLTMRTKEPSSPGTDDV
FTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgcttctgtggtctggcgccagtggcctccctccgcctcgaatctttccgtcgttgctt
gtggtggtagccttggtggggctgctgcccgttctcagaagccatggcctccagcccagc
cctaccgccagcaccatcagaggctcagagccgccccgagaacgctcaattggggatgtc
accaccgccccaccggagctcgcccccgagagccgcccagttaaccattccttcgctgaa
cacagcccaaaggctcgaaaggcctttccagtcctgggcatcgactaccaacacgtgcgc
acacccttcgaaatcgccctttggatcctactggcctgcctcatgaagataggtttccac
gtgatccccaccatctcgagcatcgtcccggagagctgcctgctgattgtggtggggttg
ctggtggggggtctgatcaagggcgtgggcgagacgccccccatcctgcagtcggaagtc
ttcttcctcttcctgctgccacccatcatcctggatgccggctacttcctgccactgcgg
cagttcacggagaacctgggcaccatcctgatcttcgccgtggtgggcacgctgtggaac
gccttcttcctgggcggcctcatgtacgccgtgtgcctggtgggcggcgagcagatcaac
aacatcggcctcctggagaacctgctgttcggcagcatcatctcggccgtggaccctgtg
gctgtgctggccgtcttcgaggagattcacatcaacgagctgctccacatccttgtgttt
ggggagtccctgctcaatgacgccgtcactgtggtcctgtatcacctctttgaggagttt
gccaactacgaccgcgtgggcatcgtggacatcattctcggcttcctgagcttcttcgtg
gtgtccctgggcggggtgttcgtgggcgtggtctacggggtcatcgcagccttcacctcc
cgcttcacctcccacatccgcgtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacctgtcggccgagctcttccacctgtcgggcatcatggcactcattgcctcgggc
gtggtgatgcgcccctacgtggaggccaacatctcgcacaagtcccacacgaccatcaag
tatttcctcaagatgtggagcagcgtcagcgaaaccctcatcttcatcttcctgggcgtc
tccaccgtggccggctcccaccactggaactggacatttgttatcagcaccctgctcttc
tgcctcatcgcccgagtgctgggcgtgctgggcctgacctggttcatcaacaagttccgc
atcgtgaagttgacccccaaggaccagttcatcatcgcctacgggggcctgcgaggggcc
atcgccttctccctgggctacctcctggacaagaagcacttccctatgtgtgacctgttc
ctcacggccatcatcaccgtcatctttttcaccgtctttgtgcagggcatgaccattcgg
cccctggtagacctgctggctgtgaagaaaaagcaagaaacgaagcgttctatcaacgag
gagatccacacgcagttcctggaccaccttctgacaggcatcgaggacatctgtggccac
tacggccaccaccactggaaagacaagctcaaccggtttaataagaagtacgtgaagaag
tgtctgatagctggtgagcgctccaaggagccccagctcatcgctttctaccacaagatg
gagatgaagcaggccatcgagctggtggaaagtgggggcatgggcaagatcccctcggcc
gtctccaccgtctccatgcagaacatccaccccaagtccctgccggccgagcgcatccta
ccagcactgtccaaggacaaggaagaggagatccgcaaaatcctgagaaacaacttgcag
aagaccaggcagaggctgcggtcctacaacagacacacgctggtggccgacccctacgag
gaggcctggaaccagatgctgctccggagacagaaggccaggcaactggagcagaagatc
agcaactacctgaccgtgccggcccacaagctggactcgcccaccatgtcgcgggcccgc
atcggctcagacccactggcctatgagcccaaggccgacttgcctgtgatcaccattgac
ccggcctccccgcagtcacctgagtccgtggacctggtgaacgaggagctgaagggcaag
gtcctggggctgagccgggatccgggcaggctggccgaggaggaggaggacgatgaggac
cccgatgggggcctcacgatgcggaccaaggagccctcgtccccgggcaccgacgacgtc
ttcaccccggcgccgagcgacagccccagctctcagaggatacagcgctgcctcagtgac
ccaggcccacaccccgagcctggggagggagagcctttcatccccaagggccagtag

DBGET integrated database retrieval system