KEGG   Capra hircus (goat): 102179898
Entry
102179898         CDS       T02910                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04110  Cell cycle
chx04115  p53 signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04218  Cellular senescence
chx04630  JAK-STAT signaling pathway
chx04921  Oxytocin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102179898 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102179898 (CDKN1A)
   04066 HIF-1 signaling pathway
    102179898 (CDKN1A)
   04068 FoxO signaling pathway
    102179898 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102179898 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102179898 (CDKN1A)
   04115 p53 signaling pathway
    102179898 (CDKN1A)
   04218 Cellular senescence
    102179898 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102179898 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102179898 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102179898 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102179898 (CDKN1A)
   05206 MicroRNAs in cancer
    102179898 (CDKN1A)
   05205 Proteoglycans in cancer
    102179898 (CDKN1A)
   05203 Viral carcinogenesis
    102179898 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102179898 (CDKN1A)
   05212 Pancreatic cancer
    102179898 (CDKN1A)
   05225 Hepatocellular carcinoma
    102179898 (CDKN1A)
   05226 Gastric cancer
    102179898 (CDKN1A)
   05214 Glioma
    102179898 (CDKN1A)
   05216 Thyroid cancer
    102179898 (CDKN1A)
   05220 Chronic myeloid leukemia
    102179898 (CDKN1A)
   05217 Basal cell carcinoma
    102179898 (CDKN1A)
   05218 Melanoma
    102179898 (CDKN1A)
   05211 Renal cell carcinoma
    102179898 (CDKN1A)
   05219 Bladder cancer
    102179898 (CDKN1A)
   05215 Prostate cancer
    102179898 (CDKN1A)
   05213 Endometrial cancer
    102179898 (CDKN1A)
   05224 Breast cancer
    102179898 (CDKN1A)
   05222 Small cell lung cancer
    102179898 (CDKN1A)
   05223 Non-small cell lung cancer
    102179898 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102179898 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102179898 (CDKN1A)
   05161 Hepatitis B
    102179898 (CDKN1A)
   05160 Hepatitis C
    102179898 (CDKN1A)
   05163 Human cytomegalovirus infection
    102179898 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102179898 (CDKN1A)
   05169 Epstein-Barr virus infection
    102179898 (CDKN1A)
   05165 Human papillomavirus infection
    102179898 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102179898 (CDKN1A)
   01522 Endocrine resistance
    102179898 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102179898
NCBI-ProteinID: XP_017894607
UniProt: A0A452DS08
LinkDB
Position
23
AA seq 161 aa
MSEPSRDAHQIPRSSKACRCLFGPVDSEQLRQDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPVGPRDDVGGGKRPSPSSALLQGTSQEDHLDLSLSCTLVTRS
PERPEGTPGGPGPSQGRKRRQTSMTDFYHSKRRLICSKRKP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtctgagccgtccagggacgcgcatcagatcccccgcagcagcaaggcctgccgctgc
ctctttggtccagtggacagcgagcagctgcgccaggactgcgacgccctcatggccagc
tgcgtgcaggaggcccgagagcgatggaacttcgactttgtcaccgagacgcccctggag
ggggactttgcctgggagcgcgtgaggggcctcggcctgcccaagctctacctgcccgtg
gggccccgagacgacgtgggagggggcaagcggccgagcccctcatccgccctgctgcag
ggcacgtctcaggaggaccacttggacctgtcgctgtcctgcaccctcgtgactcgctcc
cctgagcggcccgaggggacccctggtgggcctggcccctcccagggccggaaacggcgc
cagaccagcatgacagatttctaccactccaaacgcaggctgatctgctccaagaggaag
ccctaa

DBGET integrated database retrieval system