KEGG   Capra hircus (goat): 102179971Help
Entry
102179971         CDS       T02910                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
chx  Capra hircus (goat)
Pathway
chx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102179971 (SETD1B)
Enzymes [BR:chx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102179971 (SETD1B)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102179971 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     102179971 (SETD1B)
    COMPASS/SET1 complex (yeast)
     102179971 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 102179971
NCBI-ProteinID: XP_017916785
LinkDB All DBs
Position
17
AA seq 1966 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSAGCGSGS
SSVTPNSGGTPFSQDTAYSSCRLDTPNSYSQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPTTTFKARRHESKFTDAYNRRHEHHYVHNSSAVTAVAGATATFRGAVDLPFGAVGGS
GGSSGPPFKAQPQDSATFAHTPPPTQATPAPGVTFKSAFSPYQTPVPPFPPPPEEPTTTA
PFGARDSSEFRRAPAPPPLPPAEPLTKEKPGTPPGPPPPEANSIELGGRPTFGWSPEPCD
SPGTPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSS
QLSPLAPFGANSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDGELDLGLGPRPPPEP
GPPDPTGLLGQTSEAALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPK
PMVVTPGAGAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPP
AHPAVTVPPPPLPAPPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGSMPMSFQM
QTQMLSRLMTGQGTCPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLGNTGPGRGQPWPPL
PKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWW
DKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLSYEGLGLGIGLRGAI
RLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKGV
GVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTEEEE
EGEGEDEGEEGPRSQLSSSSTSSMSDKDDDDEDSDDRDESENEDEDTALSEASEKEEGDS
DGEETVSITTSKPEAESSSESSESSDFASSSESSSSSSSEDEEELPAGEEEEEEEEEGEA
AAVESTAPAAPDEDFESEVVTGVPTMESRGPEEEVDIEAEDEAPKEQTPMLEEPPLPVSV
EELAGCKEPPREPGLNQEGARLLSPEPPAGEKEAQPLPSPEPTPEDNLEAEPESPALLSL
PLQPPLPPSRPPRPPSPPPEPETPDLPIPSVPLEPPHHEEQPPRTPSLCGSLGKSQSAEA
VPATPSGEPLPTVGSGGLALSSPQLPGSPFSYPSPSPSLSSGGLPRTPGRDFSFTPTFPE
PGGPLLLPVCPLPAGRRDDRSGPLASPVLLETGLPLPLPLPLPLPLALPVPVLRAQSRAP
TQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLTLDGPLVRPPGGAALGRDLLLLPGQPQ
TPVFPSTHDPRTVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELENQWPSEA
IPPGPRGRDEISDEFMAKVRGSWRRPPKKRHEDLVVSASPELSPPQPLFRPRSEFEEMTI
LYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIR
EHMTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGSERRSE
QRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQN
IRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVE
SQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5901 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctttg
aaaaaggggcatcataaactgtaccgctacgatgggcagcatttcagccttgcgatgtcc
agcaaccgcccggtggaaattgtcgaagatccccgggtggtcggcatctggacaaaaaac
aaggagctggagctgtcggtccccaaattcaagatcgatgagttctatgtgggcccggtg
cctccgaagcaggtgacatttgccaagctgaatgataacatccgtgaaaacttcctaagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccccaagacc
aagaagcacttgggcattgccaaagtggtctttgccacggtcaggggagccaaggaggcc
gttcagcacttgcatagcacttcggtcatgggtaatatcatccacgtggagctggacacc
aaaggggaaacccgcatgcggttctacgaactattggtcacgggccgatacacaccccaa
accctgccagtgggtgagctggacgctgtctctccaatcgtgaatgagaccctgcagcta
tcagatgccctgaagcgcctcaaagatggtggcctgtctgcaggctgtggctctggctca
tcctctgtcacccccaatagtggtgggacacccttctcccaggacacagcttattccagc
tgccgcttggacacacccaactcctacagccagggcacgccactcacgccacgactgggc
acccccttctcgcaggactcgagttattccagccgccagcccacgccctcctacctcttc
agccaggaccccacaacgaccttcaaggctcggcgccacgagagcaagttcacagatgcc
tacaaccgccgccacgagcaccattatgttcacaactcgtctgctgtcactgcggtggca
ggggccacagctaccttccggggcgcagtggacctcccatttggggcagttggcggcagt
gggggcagcagtgggcccccattcaaggcccaaccgcaggattccgccacgtttgcccac
actcctccacccacccaagcaacccctgcacccggagtcaccttcaagtcagctttctct
ccgtatcagactcccgtgcccccttttcccccgccccccgaggagcccaccaccacagcc
ccctttggggcccgtgacagcagcgagttccgaagagcacctgcgcccccacccctgcca
cctgccgagcccctgacaaaggagaagcctggcacaccgccgggacccccgccccctgag
gccaacagcatagagctgggtggtcggccaaccttcggctggagtcctgagccctgcgac
agtcccggcacgcctacgctggagtcatcacccgcagggccggagaagccccatgacagc
ctggactctcggatcgagatgctgctgaaggagcagcgcaccaagctgcccttccttcgg
gagcaggactcagacacagagctgcagatggagggcagcccaatctcctcctcctcctcc
cagctctccccactggccccctttggcgctaactctcagccaggctttcgaggccctaca
ccaccctcctcgcgcccctccagcactggcctggaagatatcagccccacgccactgcct
gactcagatgaggatggtgagcttgatctgggcctggggcctcggcccccaccggagccg
ggtcccccagaccctaccggtcttctgggtcagacaagtgaggcggccttggacctggct
ggagacaggaccccaacctcagagaagatggatgaggggcagcagtcctcaggcgaggac
atggaaatctcagatgacgagatgccctcggcccccatcaccagtgctgactgccccaag
cccatggtggtgaccccaggggccggggccgtggcagctccctccgtgctggccccaacc
ttgccactgcccccgccccctggcttccctccactgccaccgcccccacccccgccccca
ccccagcccggcttccccatgcccccacctctgccgccaccaccgcctccgccacccccg
gcccatccagctgtgacagtgccccctccgcccctgccagccccgccgcctggtgtccca
cccccacccattctgccaccactgccgcccttcccaccagggctgtttcctgtgatgcaa
gtggacatgagccacgtgctggggggccagtggggcagcatgcccatgtccttccagatg
caaacgcagatgctgagccgtctgatgacaggccagggcacatgcccctacccccccttc
atggctgccgcagctgcagctgcctccgctgggctgcagtttgtcaacctgccgccctac
cggggccccttctcccttggtaacactggcccaggccgcgggcagccctggccacccctg
cccaagtttgacccatcagtgccgccaccaggctatgtgccgcgccaggaggacccgcac
aaggccactgtggacggcgtcctactggtggtgctcaaagagctcaaggccatcatgaag
cgggacctgaaccgcaagatggtggaggtggtggccttcagggccttcgatgagtggtgg
gacaagaaggaacggatggctaaggcctcgctgaccccggtgaagtcgggtgagcacaaa
gatgaggacaggccgaagcccaaggaccgcatcgcctcctgcctgctggagtcctggggc
aagggtgagggcctgagctacgaggggctgggcctcggcattgggctgcgtggggccatc
cgcctgccctccttcaaggtcaagaggaaggaaccaccggacacagcctcgtctggtgac
cagaagcggttgcgaccctccacctctgtggatgaggaggacgaagagtctgagcgcgag
cgggaccgggacatggccgatgccccctgtgagctcgccaagcgggaccccaagggcgtg
ggcgtgcggcggcggccagcccggcccctggagctggacagcggcggggaggaggatgag
aaggagtcgctgtcagtgtcgtcatcctcatcagcatcctcgtcctctggctcctcgacc
acctcaccctcatcctcagcctctgacaaggaggagcgagaaagcacggaggaggaagag
gagggggagggcgaggacgagggggaggagggccccaggagccagctctcctcctcctca
acctcatccatgtcagataaggatgatgatgatgaagacagcgacgaccgggatgagtct
gagaatgaagacgaggacacagccctgtcagaggcgagtgagaaggaagaaggggactca
gatggagaggagacggtgagtatcaccacctccaagcctgaagctgagtcctccagtgag
agttctgagtcatctgactttgcatcaagctctgagtcctcttcatcatcatcctcggaa
gatgaagaagagctaccagctggggaggaggaagaagaggaggaggaggaaggggaggca
gctgcagttgagagcacggctcccgctgctcctgacgaggactttgagagtgaagtggtc
acaggagtgcccacaatggagtcacggggcccagaagaggaggtggacattgaggctgag
gacgaggcccctaaggagcagaccccgatgctggaagagccccccttgcctgtgagtgtc
gaggagctggctggctgcaaggagccccccagggaaccaggcctgaaccaagaaggggcc
aggttgctgtctccagaaccccctgcaggagagaaggaggcccagcccctgccatcccca
gagcccaccccagaggacaacctggaagcggagcctgagtccccggcgctgctctcttta
ccactgcagccaccattgccgccgtctcgaccacctcggccacccagcccaccaccagag
cccgagaccccagacctccccatcccatccgtccctctggagcctccccaccatgaggag
cagcccccacgtactccgagcctctgtggcagcctgggcaagtcccagagtgccgaggcg
gtgccggccacgccgagcggggagcccttgccgacagtgggcagtggcggcctggccctg
agctccccgcagctgcccggtagccccttttcctatccatccccatcccccagcttgagc
agcgggggcctcccaaggacacctggccgggacttcagcttcacacccaccttccccgag
cctggggggcccctacttctgcctgtctgccccctcccagctggccggcgtgacgatcgg
tctggccccctggcctccccggtgctcctggagacaggcctgccgcttcctctgcctttg
cccttgcccctgcccctggcgttgcctgtacccgtcctgcgggcccagtcacgggccccc
acccagctgccacctctgctgcctgctccactggccccctgcccaccccccatcaagagg
aagccgggccggccccggcgatccccgccagctgtgctcaccttggatgggcctttggtc
cgaccgccaggaggggctgccctgggcagggacctcctgcttcttcctggccagccacag
acccctgtcttccccagcacccatgatccccggaccgtgaccctggacttccggaacgcg
gggatcccagcccccccaccacccttgccccctcaaccccctccacccccacctccacca
cctgttgagcccaccaagctgccctttaaggagctagagaaccagtggccttccgaggcc
atacctccgggtccccgtgggcgtgatgagatctccgacgagttcatggccaaggtgcgg
gggtcctggcgccggccaccgaagaagcgccatgaggacctggtggtctcagcctcgccc
gagctctcgccaccgcagcctctcttccggccccgctcagagtttgaggagatgaccatc
ctctatgacatctggaatggtggcatcgacgaggaggacatccgcttcctgtgtgttacc
tacgagcggctgctgcagcaggacaacggcatggactggctcaacgacacactctgggtc
taccatccctccaccagcctctcttcagctaagaagaagaaacgggacgacggcatccgg
gagcacatgacaggctgtgcccgcagcgagggcttctataccatcgacaagaaggacaag
ctcagatacctcaacagcagtcgtgccagcaccgacgagccccccacagacacccagggc
atgagcattcccgcgcagccgcacgcctccacacgggcaggctcagagcggcgatctgag
cagcggcgcctgttgtcttccttcactggcagttgtgacagtgacctgctcaagttcaac
cagctcaagtttcggaagaaaaagctcaaattctgcaagagtcacattcacgactggggc
ctgtttgccatggagcccatcgcggccgacgagatggtcatcgagtacgtgggccagaac
atccgccaggtgatcgcggacatgcgggagaaacgttacgaggacgagggcatcggtagc
agctacatgttccgcgtggaccacgacaccatcattgacgccaccaagtgcggcaacttc
gcacgtttcatcaaccacagctgcaaccccaactgctatgccaaggtgatcacggtggag
tcgcagaaaaagatcgtcatctattccaagcagcacatcaacgtcaatgaggagatcacc
tatgactacaagttccccatcgaggacgtcaagatcccctgcctctgtggctctgagaac
tgccgggggaccctcaactag

DBGET integrated database retrieval system