KEGG   Capra hircus (goat): 102180069Help
Entry
102180069         CDS       T02910                                 

Gene name
ACADS
Definition
(RefSeq) acyl-CoA dehydrogenase, C-2 to C-3 short chain
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00071  Fatty acid degradation
chx00280  Valine, leucine and isoleucine degradation
chx00410  beta-Alanine metabolism
chx00640  Propanoate metabolism
chx00650  Butanoate metabolism
chx01100  Metabolic pathways
chx01200  Carbon metabolism
chx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102180069 (ACADS)
   00650 Butanoate metabolism
    102180069 (ACADS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102180069 (ACADS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102180069 (ACADS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102180069 (ACADS)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     102180069 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 102180069
NCBI-ProteinID: XP_017916611
UniProt: A0A452ED98
LinkDB All DBs
Position
17
AA seq 412 aa AA seqDB search
MAATLLARACGLVRGAPWPWGWRRLHTVYQSVELPETHQMLRQTCRDFAEKELFPIAAQV
DKEHRFPEAQVKKMGELGLMAMDVPEELGGAGLDYLAYSIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGTKEQKQRWVTPFTSGEKIGCFALSEPGNGSDAGAAATTARADGDSWVLS
GTKAWITNAWEASAVVVFASTDRSLYNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTAN
LIFEDCRIPKDSLLGEPGLGFKVAMQTLDMGRIGIASQALGIAQAALDCAVSYAENRSAF
GAPLTKLQSIQFKLADMALALESARLLTWRAAMLKDNKKPFTKEAAMAKLAASEAATAIT
HQAMQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVVAGHLLKSYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctgccacgctgctcgcccgggcctgtggccttgtccgcggagccccctggccttgg
ggctggcgtcgcctacataccgtctaccagtctgttgaattgcccgagactcaccagatg
ctgcggcagacgtgccgcgactttgccgagaaggagctctttcccatagcagcccaggtg
gacaaggagcatcgcttcccagaagctcaggtgaagaagatgggcgagctggggctcatg
gccatggacgtgcccgaggagctcggcggagccggcctcgattacctggcctactccatc
gccatggaggagatcagccggggctgcgcctccacgggagtcatcatgagtgtcaacaat
tccctctacttagggcccatcctgaagttcggcaccaaggagcagaagcagcggtgggtc
actcccttcactagtggcgagaagatcggctgcttcgccctcagtgaaccagggaacggc
agcgatgcaggggccgcggccaccaccgcgcgggcagacggtgactcgtgggtcctgagt
ggcaccaaggcctggatcaccaacgcctgggaggcctcagccgtcgtggtcttcgccagc
accgacagatccttgtataacaagggcatcagtgccttcctggtccccatgcccacaccc
gggctcacgctggggaagaaggaagacaagctgggcatccgggcctcgtccacggccaac
ctcatcttcgaggactgtcgcatccccaaggacagcctgctgggggagccggggctgggc
ttcaaggtcgccatgcaaaccctggacatgggccgcatcggcatcgcctcccaggccctg
ggcatcgcccaggccgcgctggactgtgctgtgagctacgccgagaaccgcagtgctttc
ggggcgcccctcaccaagctgcagagcatccagttcaagttggcggacatggccctggcc
ctggagagtgcccggctgctgacctggcgcgctgccatgctgaaggacaacaagaagcct
ttcaccaaggaggcggcaatggccaagctggctgcatcggaggccgcaactgccatcacc
caccaggccatgcagatcctgggcggcatgggctacgtgacggagatgccggctgagcgg
cactaccgcgacgcccgcatcaccgagatttatgagggcaccagtgagatccagaggctg
gtggtcgccgggcacctgctcaagagctaccggagctga

DBGET integrated database retrieval system