KEGG   Capra hircus (goat): 102180076
Entry
102180076         CDS       T02910                                 

Gene name
JUP
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
chx  Capra hircus (goat)
Pathway
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
chx05226  Gastric cancer
chx05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180076 (JUP)
   05202 Transcriptional misregulation in cancer
    102180076 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    102180076 (JUP)
   05221 Acute myeloid leukemia
    102180076 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102180076 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102180076 (JUP)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102180076 (JUP)
SSDB
Motif
Pfam: Arm HEAT Cnd1 V-ATPase_H_N Adaptin_N HEAT_2 Atx10homo_assoc DUF3361 KAP Arm_2 PUL
Other DBs
NCBI-GeneID: 102180076
NCBI-ProteinID: XP_013827679
UniProt: A0A452G6Z9
LinkDB
Position
19
AA seq 745 aa
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGLMEEDEACGRQYTLKKTTT
YTQSVPPGQGDLEYQMSTTARAKRVREAMCPGVTGEDSSLLLATQVEGQTTNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDIAEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPMNEPYADDMDATYRPMYSSDVPMDPLEMHMDM
DGDYPIDTYSDGLRPPYPTADHMLA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggtgatgaacctgatcgaacagcccatcaaggtgaccgagtggcagcagacatat
acctatgactctggcatccactcgggggccaacacctgtgtgccctcggtcagcagcaag
ggcctcatggaggaggacgaggcctgcgggcgccagtacacactcaagaagaccaccacc
tacacccagtcggtgcccccgggccaaggtgacctggagtaccagatgtccacgactgcc
agagccaagcgggtgcgggaggccatgtgtcccggtgtgacaggagaggacagctcactg
ctgctggccacccaggtggaggggcagaccaccaacctgcagcggctggccgagccatcc
caactcctcaagtcggccatcgtgcatctcatcaactaccaggacgacgctgagctggcc
acccgggccctgcctgagctcaccaagctgctcaatgatgaggacccggtggtggtgacc
aaggcggccatgattgtgaaccagctgtcgaagaaggaggcgtctcggcgggcgctaatg
ggctcgccccagctggtggcggccgtcgtgcgcaccatgcagaacaccagcgacctggac
accgcccgctgcaccaccagcatcctgcacaacctctcccaccaccgcgaggggctgctt
gccatcttcaagtcgggcggcatccctgccctggtccgcatgctcagctcccctgtggag
tcggtcttgttctatgccatcaccacgctgcacaacctgctgctctaccaggagggtgcc
aagatggcagtgcgcctggcagacgggctgcagaagatggtgcccctgctcaacaagaac
aaccccaagttcctggccatcaccaccgactgcctgcagctcctggcctatggcaaccag
gagagcaagctcatcatcctggccaatggaggaccccaggccctcgtccagatcatgcgt
aactacagttatgagaagctgctctggaccaccagccgcgtgctcaaagtgctgtccgtg
tgtcccagcaacaagcctgccattgtggaggctggtgggatgcaggccctgggcaagcac
ctgacgagcaacagcccccgcctcgtgcagaactgcctgtggaccctgcgcaacctctcg
gatgtggccaccaagcaggagggcctggagagcgtgctgaagattctagtgaaccagctg
agcgtggacgatgtcaacgtcctcacctgtgccacgggcactctgtccaacctgacgtgc
aacaacagcaagaacaagacgctggtgacgcagaacagtggtgtggaggcgctcatccac
gccatcctgcgtgcgggcgacaaggacgacattgcggagcccgctgtctgcgccctgcgc
cacctcaccagccgccaccccgaggctgagatggcccagaactccgtgcgtctcaactat
ggcatcccggccatcgtcaagctgctcaaccagcccaaccagtggccactggttaaggca
accattggcctgatcaggaatctggccctgtgcccagccaaccatgccccactgcaggag
gcagcggtcattccccgccttgtccaactgctggtcaaggcccaccaggatgcccagcgc
catgtggctgctggcacacagcagccctacacggatggcgtgaggatggaggagattgtg
gaaggctgcactggagccctgcacatcctcgcccgggatcccatgaaccgcatggagatc
ttccgactcaacaccatccccctgtttgtgcagctcctctactcctccgtggagaacatc
cagcgcgtggccgccggggtgctgtgcgagctggcccaggacaaggaggcggcggacgcc
atcgatgcggagggcgcgtcggccccactcatggagctactgcactcgcgcaatgagggc
accgccacctacgccgctgccgtcttgttccgcatctccgaggacaagaacccagattac
cgcaaacgggtgtctgtggagctcactaactccctcttcaagcacgaccctgccgcctgg
gaggctgcccagagcatgatccccatgaatgaaccctatgctgatgacatggacgccacc
taccgccccatgtactcgagcgacgtgcccatggacccactggagatgcacatggacatg
gatggggactatcccattgacacctacagcgacggcctcaggcccccctacccaactgca
gaccacatgctggcctag

DBGET integrated database retrieval system