KEGG   Capra hircus (goat): 102180100
Entry
102180100         CDS       T02910                                 

Gene name
ITGAM
Definition
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
chx  Capra hircus (goat)
Pathway
chx04015  Rap1 signaling pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04610  Complement and coagulation cascades
chx04613  Neutrophil extracellular trap formation
chx04640  Hematopoietic cell lineage
chx04670  Leukocyte transendothelial migration
chx04810  Regulation of actin cytoskeleton
chx05133  Pertussis
chx05134  Legionellosis
chx05140  Leishmaniasis
chx05146  Amoebiasis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102180100 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102180100 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102180100 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102180100 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102180100 (ITGAM)
   04610 Complement and coagulation cascades
    102180100 (ITGAM)
   04613  Neutrophil extracellular trap formation
    102180100 (ITGAM)
   04670 Leukocyte transendothelial migration
    102180100 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102180100 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102180100 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102180100 (ITGAM)
   05134 Legionellosis
    102180100 (ITGAM)
   05150 Staphylococcus aureus infection
    102180100 (ITGAM)
   05152 Tuberculosis
    102180100 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102180100 (ITGAM)
   05140 Leishmaniasis
    102180100 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102180100 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102180100 (ITGAM)
   04515 Cell adhesion molecules [BR:chx04515]
    102180100 (ITGAM)
   04090 CD molecules [BR:chx04090]
    102180100 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    102180100 (ITGAM)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102180100 (ITGAM)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102180100 (ITGAM)
Cell adhesion molecules [BR:chx04515]
 Integrins
  Integrin alpha subunits
   102180100 (ITGAM)
CD molecules [BR:chx04090]
 Proteins
  102180100 (ITGAM)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   102180100 (ITGAM)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS Integrin_alpha TMEM18
Other DBs
NCBI-GeneID: 102180100
NCBI-ProteinID: XP_005697792
UniProt: A0A452EK18
LinkDB
Position
25
AA seq 1152 aa
MNHRILLLTALALCHGFNLDTEKAVIFQNNARGFGQSVVQIQGSRLVVGAPQEVKAANQT
GGLYQCDYSTGRCEAIPLQVPPEAVNMSLGLSIVFAANPFRLLACGPTVHQICKENTYAN
GLCFLFGSNLLQKPRRIPAALRECPQQDSDIAFLIDGSGSIDPEDFEQMKKFVSTVMSRF
QKSKTLFALMQYSDDFQTHFTFNDFKRNSDPELLVRPIRQLFGRTHTATGIRKVVRELFH
SSNGARNHALKIMIVITDGEKYLDPLEYRDVIPEADRKGIIRYVIGVGDAFNSKKSRKEL
DTIASKPPADHVFQVNNFEALKTIQNQLQEKIFAIEGTQTGSTSSFEYEMSQEGFSAAFT
SDGPLLGAVGSFDWAGGAFLHTSKDKITFINTSRIDSDMNDAYLGYAAEVTSRNWVQNLF
LGAPRYQHIGLVVIFRQNAGVWEKNAEIKGSQIGSYFGASLCSVDVNRDGSPDLVLIGAP
HFYEQMRGGQVSVCPFPRGRAKWKCDAVLQGEPGHPWGRFGAALTALGDVNGDRLVDVAI
GAPGEQENRGAVYLFHGTSELGISPSHSQRITGSQISPRLQYFGQSLSGGQDLTMDGLVD
LAVGAQGHVLLLRSQPVLKVEVTMEFTPKEVKRNVYECRDPVVKGQIAGKVKVCLQVRKS
TWDRLGEGDTQSTITYDLALDPGRPHSLAIFDDTQNSTRRHVETLRLSQKCETLTLRLLD
CVEDSVTPISLRLNFSLVGEPAHNYGGLRPVLGVDALRLFTASLPFEKNCGNDTVCQDDL
SITFNFMGLDTLVVGGPRDLNVTVTVRNEGEDSYRTQVTFFYPSGLSFRRVSSSQNQRSH
RFWRLACESDVSTEGFGILRRLSCGINHPIFPDNSEITFNVTFDVNPDTYFGNKLLLKAN
VTSENNMPGNNKTHFQLELPVKYAVYMVVTSLEASTKYLNFTASEKTRHVMKHQYQFNNL
GRKKLPISVVFWIPIRLNKVTVWSQPQVTFSQNMSSGCHTTEVAPRHSDFLAELKKSPML
NCSVAVCQRIQCTIPSFGVQEEFKVTLQSNLSFDWYIKTSHNHLQVVSKAEILFDESEFT
LLPGQDAFVMAQTETKVESYEIHNPVPLIVGSSVGGLVLLALISAGLYKLGFFKRQYKDM
MTEAGPDAATPQ
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgaatcacagaatccttctactaacagccttggccttatgtcatgggttcaacctggac
acggaaaaagcagtcatcttccaaaacaacgcaaggggcttcgggcagagcgtggtccag
attcagggatcccggctggtggttggagccccccaggaggtaaaggctgctaatcaaaca
ggcggcctctaccagtgtgactacagcacgggcaggtgtgaggccatccccctgcaggtt
cccccggaggctgtgaacatgtccctgggcttgtctattgtatttgctgccaaccctttc
cggctgctggcctgcggccccacagtgcaccaaatttgcaaagagaacacttatgcaaat
ggcctctgcttcttgtttggatccaatctactccagaaacccaggaggatcccagcggcc
ctcagagagtgccctcagcaagacagtgacattgcctttctgattgatggctctggtagc
attgaccctgaagactttgagcagatgaagaagtttgtctcaactgtgatgagtcgattc
caaaagtccaaaaccttgttcgctctgatgcagtactcggatgacttccagactcacttc
accttcaatgatttcaagagaaactcagacccggaattactggtgaggccaataagacag
ctgttcgggaggacgcacacagccacggggatccgcaaagtagtaagagaactgtttcac
agcagcaatggagcccggaatcatgccctgaagatcatgattgtcatcacagatggggaa
aaatatctcgatcctttggagtatagggatgtcatccctgaagctgatagaaaagggatc
attcgctacgtcattggggtgggagatgcttttaacagtaagaaatctcgaaaggagctc
gatactattgcatctaagccgcctgctgatcacgtgttccaggtgaataactttgaagct
ctgaagaccattcagaaccagcttcaggaaaagatctttgcgattgagggtacacagaca
ggaagtaccagttcctttgaatatgagatgtctcaggaaggtttcagtgctgccttcacc
tccgatggtcctttgctgggtgctgtggggagctttgactgggctggtggagcctttctg
catacatcaaaggataaaatcaccttcatcaatacaagcaggatagattcagacatgaat
gatgcttacttgggttatgctgccgaagtcacctcgcggaactgggtgcaaaacttgttt
ctgggagcacctcgatatcagcacattggcctggtggtgatattcagacagaatgcaggt
gtttgggagaaaaacgctgaaatcaagggaagccagattggctcctactttggggcctcc
ctctgctccgtggatgtcaacagagatggcagccctgacctggtcctcatcggggccccc
catttttatgagcagatgcgagggggccaggtgtctgtgtgcccctttccccgggggaga
gctaagtggaagtgtgatgctgtcctgcaaggggagccgggccacccctggggccgcttt
ggggcagccctgacagcgctgggggatgtgaatggggacaggctggtggatgtggccatt
ggggccccgggagagcaggagaatcggggtgctgtctacctgttccatggaacctcagaa
ctgggcatcagcccctcccacagccagcggatcacaggctcacagatctcccccaggctt
cagtattttgggcagtcactgagtgggggccaggacctcacaatggatggactggtagac
ttggctgtcggggctcaggggcatgtgctgctgctaaggtcacagcctgtgctgaaagtt
gaggtgacgatggagttcacacccaaggaagtgaagaggaatgtgtatgaatgtcgtgac
ccagtggtaaaaggccagattgctgggaaggtcaaagtctgcctccaagttcgcaagagc
acatgggaccggctgggagaaggagatacccagagcactatcacctatgacctggctctg
gacccaggtcgcccccattccctggccatctttgatgacacgcagaacagcacacgcaga
cacgtagagacgctgaggctgagtcagaaatgcgagaccctgacgctccggttactggat
tgtgtagaggactcagtgacccccatttctctgcgcctcaacttctctctggtgggggag
cctgcgcacaattatgggggcctcaggccagtgctgggtgtggatgctctgagactcttc
acagcctcgcttccctttgagaagaactgtggcaatgacaccgtctgccaggatgacctc
agcattaccttcaattttatgggcctggacaccctggtggtgggtggtccccgggacttg
aacgtgacggtgactgtaagaaacgagggcgaggactcctacagaactcaggtcaccttc
ttctacccatctggcttgtccttccgaagggtgtcaagcagccagaaccagcgctcacat
cgattctggcgcctggcctgtgagtctgatgtctccactgaagggtttggaatcttgagg
agattaagctgcggcataaaccaccccattttcccagacaactcggagatcacctttaat
gtcacatttgacgtgaaccctgatacttactttggaaacaagctacttctcaaggccaat
gttaccagtgaaaacaacatgccggggaacaacaaaactcactttcagctggagctgcct
gtgaaatacgctgtgtacatggtggtcaccagccttgaggcctccaccaaatatctcaac
ttcacagcctcagagaagaccagacacgttatgaagcatcagtatcagttcaacaacctg
ggccggaagaaactgcccatcagtgtggtcttctggatccccatccggctgaacaaggtg
accgtgtggtcccagccccaagtcaccttttcccagaacatgtccagtggatgtcacacc
acagaggttgcccctcgtcactctgacttcctggcggagcttaagaagagcccaatgctg
aactgctccgttgccgtctgccagagaatccagtgtaccatcccctcctttggcgtccag
gaggagttcaaggtcaccctccagagcaacctctcatttgactggtacatcaagacttca
cacaaccaccttcaagttgtgagcaaagcagagatcttatttgatgagtcagagttcacc
ctgcttccagggcaggacgcgtttgtgatggcccagacagagaccaaggtggagtcctac
gaaatacataaccctgtcccgctgatcgtgggcagctcggtaggggggcttgtgctcctg
gccctcatctctgccggtctgtacaagctcggcttcttcaaacgacagtacaaggacatg
atgactgaagctggtcccgatgcggccaccccccagtag

DBGET integrated database retrieval system