KEGG   Capra hircus (goat): 102180248
Entry
102180248         CDS       T02910                                 

Gene name
TRADD
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04064  NF-kappa B signaling pathway
chx04071  Sphingolipid signaling pathway
chx04210  Apoptosis
chx04217  Necroptosis
chx04622  RIG-I-like receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04668  TNF signaling pathway
chx04920  Adipocytokine signaling pathway
chx05132  Salmonella infection
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102180248 (TRADD)
   04064 NF-kappa B signaling pathway
    102180248 (TRADD)
   04668 TNF signaling pathway
    102180248 (TRADD)
   04071 Sphingolipid signaling pathway
    102180248 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102180248 (TRADD)
   04217 Necroptosis
    102180248 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102180248 (TRADD)
   04657 IL-17 signaling pathway
    102180248 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102180248 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102180248 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102180248 (TRADD)
   05152 Tuberculosis
    102180248 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102180248 (TRADD)
   05160 Hepatitis C
    102180248 (TRADD)
   05164 Influenza A
    102180248 (TRADD)
   05162 Measles
    102180248 (TRADD)
   05168 Herpes simplex virus 1 infection
    102180248 (TRADD)
   05163 Human cytomegalovirus infection
    102180248 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102180248 (TRADD)
   05169 Epstein-Barr virus infection
    102180248 (TRADD)
   05165 Human papillomavirus infection
    102180248 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2 TPR_14
Other DBs
NCBI-GeneID: 102180248
NCBI-ProteinID: XP_005692184
UniProt: A0A452G086
LinkDB
Position
18
AA seq 312 aa
MAAGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHQQQKVGMYRALRTALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFSGRLACSRFLRAYREGALRATLQGCLARALALNSVPLQLELRA
GAEQLDALLTDEERCLNCICAQKPDRLRDEELTELEDALRNLTCGSAAGQGRDVQGTPAP
SQSLAPSPPEEKPPPPPPGQTFLFQGQPIVNRPLNLQDQQKFARSVGLKWRKVGRSLQRS
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLANPEGSLV
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcggctgggccaaatgggcttgaggagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaagtggtcttgtccgatgcctacgctcaccagcagcagaaagtggga
atgtacagggctctccggactgccctggcagagagtggcgggagccccgatgtgctgcag
atgctcaagatccaccgcagcgacccgcagttgatcgtgcaactgcgtttcagcgggcgc
ctggcgtgcagccgcttcctccgagcctaccgcgagggggcgctgcgagccacgctgcaa
gggtgcctggctcgggcactggccctgaactcggtgccgttgcaactggagctgcgcgct
ggcgccgagcagctggatgccttgctgaccgacgaggagcgctgtttgaactgcatatgc
gcccagaagcctgaccggctccgggatgaggaactcaccgagttggaggatgcgctcagg
aatctgacgtgcggctcggcggcgggccaagggagagatgtgcaaggcactccagccccc
tcgcagtctctggcaccttctccgccggaggagaaaccgccaccaccgccgcctggccag
acttttttgttccagggtcagcccatagtgaaccggccgctgaacctgcaggatcaacag
aagttcgcccgctccgtgggcctcaagtggcgcaaggtggggcgctctctgcagcgcagc
tgccgcgcgctgcgggacccggcgctggactcactggcctatgaatacgagcgcgaaggg
ctgtacgagcaggccttccagctgctgcggcgctttgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcgctcgaggagaacgagctcaccagcctggcggaggac
ttgctgggcctggcgaatcctgagggcagcctggtctag

DBGET integrated database retrieval system