Capra hircus (goat): 102180451 Help Entry 102180451         CDS       T02910                                  Gene name FAS Definition (RefSeq) Fas cell surface death receptor   KO K04390   tumor necrosis factor receptor superfamily member 6 Organism chx  Capra hircus (goat) Pathway chx01524   Platinum drug resistance chx04010   MAPK signaling pathway chx04060   Cytokine-cytokine receptor interaction chx04115   p53 signaling pathway chx04210   Apoptosis chx04217   Necroptosis chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx04932   Non-alcoholic fatty liver disease chx04940   Type I diabetes mellitus chx05010   Alzheimer disease chx05022   Pathways of neurodegeneration - multiple diseases chx05142   Chagas disease chx05143   African trypanosomiasis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05205   Proteoglycans in cancer chx05320   Autoimmune thyroid disease chx05330   Allograft rejection chx05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102180451 (FAS)    04668 TNF signaling pathway     102180451 (FAS)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102180451 (FAS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102180451 (FAS)    04217 Necroptosis     102180451 (FAS)    04115 p53 signaling pathway     102180451 (FAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102180451 (FAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102180451 (FAS)    05205 Proteoglycans in cancer     102180451 (FAS)   09163 Immune disease    05320 Autoimmune thyroid disease     102180451 (FAS)    05330 Allograft rejection     102180451 (FAS)    05332 Graft-versus-host disease     102180451 (FAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102180451 (FAS)    05022 Pathways of neurodegeneration - multiple diseases     102180451 (FAS)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102180451 (FAS)    04932 Non-alcoholic fatty liver disease     102180451 (FAS)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102180451 (FAS)    05161 Hepatitis B     102180451 (FAS)    05160 Hepatitis C     102180451 (FAS)    05164 Influenza A     102180451 (FAS)    05162 Measles     102180451 (FAS)    05168 Herpes simplex virus 1 infection     102180451 (FAS)    05163 Human cytomegalovirus infection     102180451 (FAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102180451 (FAS)    05169 Epstein-Barr virus infection     102180451 (FAS)    05165 Human papillomavirus infection     102180451 (FAS)   09174 Infectious disease: parasitic    05142 Chagas disease     102180451 (FAS)    05143 African trypanosomiasis     102180451 (FAS)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102180451 (FAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04050 Cytokine receptors [BR:chx04050]     102180451 (FAS)    04090 CD molecules [BR:chx04090]     102180451 (FAS) Cytokine receptors [BR:chx04050]  Tumor necrosis factor receptors   TNF receptor superfamily    102180451 (FAS) CD molecules [BR:chx04090]  Proteins   102180451 (FAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNFR_c6 Death RIFIN DUF4381 FeoB_associated Stn1_C RIO1 Na_Ca_ex_C Motif Other DBs NCBI-GeneID:  102180451 NCBI-ProteinID:  NP_001301164 UniProt:  X2KN74 LinkDB All DBs Position 26 AA seq 326 aa AA seqDB search MSGIWVHLSLIFISVSGPLSKGENAHVAGVNSEGLRLNKNITEASSCQEGLYREHLFCCQ PCPPGKRKNGECKRDGDMPECVLCSEGNEYTDKSHHSDKCIRCSVCDEEHGLEVEHNCTR TRNTKCRCKSNFFCNSSPCEHCNPCTTCEHGIIEKCTPTSNAKCKGSRSHANSLWALLIL LLILIFLIIYKVVRSRRRNKKNGNCVSAASNDEGRQLNLTDVDLGKYIPSIAELMRITEV KEFVRKNGMEEAKIDDIMHDNLHETAEQKVQLLRKWYQSHGKKNAYCTLTKNLPKALAEK ICDILMKDITNERENANLQNESENLV NT seq 981 nt NT seq  +upstreamnt  +downstreamnt atgtccgggatctgggttcacttgtcactgatattcatctctgtttctggaccactgtct aaaggtgaaaatgcccacgtggctggtgtcaactctgaggggctgagattgaataagaat attactgaagcaagttcctgccaagaaggcctatatcgtgagcatctgttctgctgtcag ccttgtcctcctggcaaacgtaaaaacggtgaatgcaaacgcgatggagatatgccagaa tgtgtgctctgctcggaggggaacgagtacacagacaagagccatcattctgataaatgc ataaggtgcagcgtctgtgatgaagaacatgggctagaagtggaacacaactgtactcgg acccggaataccaagtgcagatgcaaatcgaactttttttgtaacagttctccatgcgaa cactgtaacccttgcaccacgtgtgaacatggaatcattgagaaatgcacaccaactagc aacgccaaatgcaaaggatccagatctcacgcaaacagtttatgggccctcctgatcctc ctcctcatcctaatatttctaataatatacaaagtggtgagaagtcgacgcaggaataaa aagaatggtaattgcgtctctgcagcctcaaatgatgaagggaggcaactgaatttaaca gatgttgacttgggtaaatatatccctagtattgctgaactaatgagaataactgaagtt aaagaatttgttcggaagaatggtatggaggaagccaaaatagatgatatcatgcatgac aatctccatgaaacagctgaacagaaggtccaactgctccgcaagtggtatcaaagtcac gggaagaaaaatgcatattgtacgttgactaaaaatctcccaaaagctcttgcagagaag atttgtgacatactcatgaaggacattactaatgaacgtgaaaatgcaaacttgcaaaat gaaagtgaaaacttggtttaa

DBGET integrated database retrieval system