KEGG   Capra hircus (goat): 102180451
Entry
102180451         CDS       T02910                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
chx  Capra hircus (goat)
Pathway
chx01524  Platinum drug resistance
chx04010  MAPK signaling pathway
chx04060  Cytokine-cytokine receptor interaction
chx04115  p53 signaling pathway
chx04210  Apoptosis
chx04217  Necroptosis
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx04932  Non-alcoholic fatty liver disease
chx04940  Type I diabetes mellitus
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05320  Autoimmune thyroid disease
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102180451 (FAS)
   04668 TNF signaling pathway
    102180451 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102180451 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102180451 (FAS)
   04217 Necroptosis
    102180451 (FAS)
   04115 p53 signaling pathway
    102180451 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102180451 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180451 (FAS)
   05205 Proteoglycans in cancer
    102180451 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102180451 (FAS)
   05330 Allograft rejection
    102180451 (FAS)
   05332 Graft-versus-host disease
    102180451 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102180451 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102180451 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102180451 (FAS)
   04932 Non-alcoholic fatty liver disease
    102180451 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102180451 (FAS)
   05161 Hepatitis B
    102180451 (FAS)
   05160 Hepatitis C
    102180451 (FAS)
   05164 Influenza A
    102180451 (FAS)
   05162 Measles
    102180451 (FAS)
   05168 Herpes simplex virus 1 infection
    102180451 (FAS)
   05163 Human cytomegalovirus infection
    102180451 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102180451 (FAS)
   05169 Epstein-Barr virus infection
    102180451 (FAS)
   05165 Human papillomavirus infection
    102180451 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102180451 (FAS)
   05143 African trypanosomiasis
    102180451 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102180451 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:chx04050]
    102180451 (FAS)
   04090 CD molecules [BR:chx04090]
    102180451 (FAS)
Cytokine receptors [BR:chx04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102180451 (FAS)
CD molecules [BR:chx04090]
 Proteins
  102180451 (FAS)
SSDB
Motif
Pfam: TNFR_c6 Death RIFIN DUF4381 FeoB_associated Stn1_C RIO1 Na_Ca_ex_C
Other DBs
NCBI-GeneID: 102180451
NCBI-ProteinID: NP_001301164
UniProt: X2KN74
LinkDB
Position
26
AA seq 326 aa
MSGIWVHLSLIFISVSGPLSKGENAHVAGVNSEGLRLNKNITEASSCQEGLYREHLFCCQ
PCPPGKRKNGECKRDGDMPECVLCSEGNEYTDKSHHSDKCIRCSVCDEEHGLEVEHNCTR
TRNTKCRCKSNFFCNSSPCEHCNPCTTCEHGIIEKCTPTSNAKCKGSRSHANSLWALLIL
LLILIFLIIYKVVRSRRRNKKNGNCVSAASNDEGRQLNLTDVDLGKYIPSIAELMRITEV
KEFVRKNGMEEAKIDDIMHDNLHETAEQKVQLLRKWYQSHGKKNAYCTLTKNLPKALAEK
ICDILMKDITNERENANLQNESENLV
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtccgggatctgggttcacttgtcactgatattcatctctgtttctggaccactgtct
aaaggtgaaaatgcccacgtggctggtgtcaactctgaggggctgagattgaataagaat
attactgaagcaagttcctgccaagaaggcctatatcgtgagcatctgttctgctgtcag
ccttgtcctcctggcaaacgtaaaaacggtgaatgcaaacgcgatggagatatgccagaa
tgtgtgctctgctcggaggggaacgagtacacagacaagagccatcattctgataaatgc
ataaggtgcagcgtctgtgatgaagaacatgggctagaagtggaacacaactgtactcgg
acccggaataccaagtgcagatgcaaatcgaactttttttgtaacagttctccatgcgaa
cactgtaacccttgcaccacgtgtgaacatggaatcattgagaaatgcacaccaactagc
aacgccaaatgcaaaggatccagatctcacgcaaacagtttatgggccctcctgatcctc
ctcctcatcctaatatttctaataatatacaaagtggtgagaagtcgacgcaggaataaa
aagaatggtaattgcgtctctgcagcctcaaatgatgaagggaggcaactgaatttaaca
gatgttgacttgggtaaatatatccctagtattgctgaactaatgagaataactgaagtt
aaagaatttgttcggaagaatggtatggaggaagccaaaatagatgatatcatgcatgac
aatctccatgaaacagctgaacagaaggtccaactgctccgcaagtggtatcaaagtcac
gggaagaaaaatgcatattgtacgttgactaaaaatctcccaaaagctcttgcagagaag
atttgtgacatactcatgaaggacattactaatgaacgtgaaaatgcaaacttgcaaaat
gaaagtgaaaacttggtttaa

DBGET integrated database retrieval system