KEGG   Capra hircus (goat): 102180574Help
Entry
102180574         CDS       T02910                                 

Gene name
CLEC6A
Definition
(RefSeq) C-type lectin domain family 6 member A
  KO
K17514  C-type lectin domain family 6 member A
Organism
chx  Capra hircus (goat)
Pathway
chx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102180574 (CLEC6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:chx04054]
    102180574 (CLEC6A)
   04091 Lectins [BR:chx04091]
    102180574 (CLEC6A)
Pattern recognition receptors [BR:chx04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   102180574 (CLEC6A)
Lectins [BR:chx04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    102180574 (CLEC6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C MHC2-interact
Motif
Other DBs
NCBI-GeneID: 102180574
NCBI-ProteinID: XP_005680959
UniProt: A0A452DV24
LinkDB All DBs
Position
5
AA seq 206 aa AA seqDB search
MVREGNAESCFRVRLWCIAVLGLALLSACFIVSCVVTYYFTYGNTGKRLSELHTHHSNLT
CFSEGTRVTEKIWGCCPGTWKPFGSSCYFISSEENFWAKSEQNCIGMGAHLVVINTETEQ
DFIIQQLNKTFSYFLGLSDPQGNGNWQWIDQTPYKENVRFWHQNEPNFSAEECASVVFWD
GRGWGWNDVFCDSKRKSICEMKKIYL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgggaagggaatgcagaatcctgcttccgggtgaggctctggtgtattgcggta
cttggcttagccctcctcagtgcatgcttcattgtgagctgtgtggtgacttattatttt
acatatggcaacactggcaaaaggctgtctgaacttcacacacatcattcaaatctaacc
tgcttcagtgaagggacaagggtgacagaaaagatttgggggtgttgcccaggtacctgg
aagccgttcggttccagctgctactttatttcttctgaagagaatttctgggctaagagt
gagcagaactgcattgggatgggagctcacttggtggtgatcaacacagaaacagagcag
gatttcattatccagcagctgaataaaacattttcgtattttctgggactctcagaccca
caagggaatggcaactggcaatggattgatcagactccttacaaggaaaatgtcagattt
tggcaccaaaatgaacccaacttttctgcagaggaatgtgcctcagttgttttctgggat
gggagaggatggggctggaatgatgttttctgtgattctaaaaggaaatcaatatgtgag
atgaagaagatttacctatga

DBGET integrated database retrieval system