KEGG   Capra hircus (goat): 102180652Help
Entry
102180652         CDS       T02910                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
chx  Capra hircus (goat)
Pathway
chx00430  Taurine and hypotaurine metabolism
chx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102180652 (CSAD)
Enzymes [BR:chx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     102180652 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DUF4910 SepSecS DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102180652
NCBI-ProteinID: XP_017903174
LinkDB All DBs
Position
5
AA seq 493 aa AA seqDB search
MADSQPLLSLDGDPVAAEALLQDVFGIVVDEVIRKGTSASEKVCEWKEPEELKQLLDLEL
RHEGESQEQILEHCRAVIRYSVKTCHPRFFNQLFSGLDPHALAGRIVTESLNTSQYTYEI
APVFVLMEEEVLKKLRALVGWSSGDGVFCPGGSISNMYAVNLARYQRYPDCKQRGLRALP
PLALFTSKECHYSIKKGAAFLGLGTDSVRVVEADERGKMIPEDLERQISLAKAEGAVPFL
VSATSGTTVLGAFDPLEAIADVCQHHGLWLHVDAAWGGSVLLSQTHRHLLAGIQRADSVA
WNPHKLLSTGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRV
DCLKLWLMWKAQGGQGLQRRVDQAFALARYLVEELKKREGFELVMEPEFVNVCFWFVPPS
LRGKKESPDYSERLSKVAPILKERMVRKGSMMIGYQPHGTRSNFFRMVVANPALTRADMD
FLLNELERLGQDL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgactctcaaccgctcctctcccttgatggggaccctgtggctgcagaagccttg
ctccaggatgtgtttgggattgtggtggatgaggttattcgaaaagggaccagtgcctcc
gagaaggtctgtgagtggaaggagcccgaggagctgaagcagctgctggacttggagctg
cggcacgagggcgagtcacaggagcagatcctggagcactgccgggccgtgatccgatac
agcgtgaagacctgtcaccctcgtttcttcaaccagctcttctcagggttggatccccat
gccctggccgggcgcattgtcacagagagcctcaacaccagccagtacacgtacgaaatc
gcccctgtgtttgtcctcatggaggaggaggtgctgaagaaactccgggccctggtgggc
tggagctctggggacggggtcttctgtcctggtggctccatctccaacatgtatgctgtg
aacctggcccgctatcagcgatacccagactgcaaacagaggggcctccgggcactgccg
cccctggccctcttcacatcgaaagagtgtcattactccatcaagaaaggagccgctttt
ctgggacttggcaccgacagtgtccgagtggtcgaggcagatgagagagggaaaatgatc
cctgaggatctggagaggcagatcagcttggccaaggccgagggcgccgtgccattcctg
gtcagtgccacctctggtaccacagtgctgggggcctttgaccccctggaggcaatcgcg
gatgtgtgccagcatcacgggctgtggctgcatgtggacgctgcctggggtgggagcgtc
ctgctgtcacagacacatagacatctcctggctggcatccagagggctgactccgtggcc
tggaatccccacaagctcctctccacaggcctgcagtgctcagctcttcttctccgggac
acctcgaacctgctcaagcgctgtcacgggtcccaggccagctacctcttccagcaggac
aagttctacgacgtggctctggacacgggagacaaggtggtgcagtgtggccggcgtgtg
gactgtctgaagctgtggctcatgtggaaggcacagggcgggcaggggctgcagcgccgt
gtggaccaggcctttgcccttgcccggtacctggtggaggagctgaagaagcgggaggga
tttgagttggtcatggagcctgaatttgtcaacgtgtgtttctggttcgtgccccccagc
ctgcgggggaagaaggagagtccagattacagtgaaaggctgtctaaggtagccccaatc
ctcaaggagcgcatggtgaggaagggttccatgatgattggctaccagccccatggtacc
cggagcaacttcttccgcatggtcgtggccaaccctgcgctgacacgggctgatatggac
ttcctgctgaatgagctggaacggctgggccaggatctctga

DBGET integrated database retrieval system