KEGG   Capra hircus (goat): 102180670
Entry
102180670         CDS       T02910                                 

Gene name
JAK2
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04062  Chemokine signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04630  JAK-STAT signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04725  Cholinergic synapse
chx04917  Prolactin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05200  Pathways in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102180670 (JAK2)
   04151 PI3K-Akt signaling pathway
    102180670 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102180670 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102180670 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102180670 (JAK2)
   04659 Th17 cell differentiation
    102180670 (JAK2)
   04062 Chemokine signaling pathway
    102180670 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102180670 (JAK2)
   04917 Prolactin signaling pathway
    102180670 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    102180670 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    102180670 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180670 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102180670 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102180670 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102180670 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102180670 (JAK2)
   05164 Influenza A
    102180670 (JAK2)
   05168 Herpes simplex virus 1 infection
    102180670 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102180670 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102180670 (JAK2)
   05140 Leishmaniasis
    102180670 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102180670 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102180670 (JAK2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102180670 (JAK2)
Protein kinases [BR:chx01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102180670 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 102180670
NCBI-ProteinID: XP_017907511
UniProt: A0A452DQ72
LinkDB
Position
8
AA seq 1132 aa
MGMACLTMTEMEGTSTSPVHQNGDISGNANSVKQIDPVLQVYLYHSLGKAEEDYLKFPTG
EYVAEEICIAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESTRQNVLYRIRFYF
PYWYCNGSNRTYRHGIARGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKNQTPLDIYSSISYKTFLPKCVRAKIQEYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDISIKQANQEGANESRIVTIHKQDGKSLEIELKSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPISMDFAISKLKKTGNQT
GLYVLRCSPKDFHKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTSGVSDVPTSPALQRHNNVNQMVFHKI
RNEDLVFNESLGQGTFTKIFKGIRREIGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLILNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKTLIHGNVCAKNVLLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRHNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLAVRVDQIRDNMTG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcttgccttacaatgacagaaatggaaggaacatccacatcccctgtgcat
cagaatggtgatatttctggaaatgctaactctgtgaagcaaatagatccagtcctacag
gtctatctttatcattcccttgggaaagctgaggaggattatctgaagtttccaactgga
gagtatgttgctgaagagatttgtattgctgcttctaaagcttgtggaatcacacctgta
tatcatagtatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgaatcaaccaggcaaaacgtactctacagaatcagattttacttt
ccttactggtattgtaatggcagcaacagaacctatcgacatggaatagctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctttttgctcagtggcggcatgat
tttttacatggatggataaaagtgcccgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaagaatcaaacgccactggacatc
tatagctctatcagctacaagacatttttgccaaaatgtgttcgagcaaagatccaagag
tatcatattttgacaaggaagagaataaggtacagatttcgcagatttattgagcaattc
agccattgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttgtattgtgatttt
cctgatattattgatatcagtattaaacaagcaaatcaagaaggcgcaaatgaaagcaga
attgtaactattcataagcaagatggtaaaagtctagaaattgaacttaagtcattaaga
gaagctttgtcttttgtgtcattaattgatggatattatagattaactgcagatgcacat
cattatctttgtaaagaagtagcacctccaatggtgcttgaaaatatacaaagcaactgt
catggcccaatttcaatggattttgctatcagtaaactgaagaaaacaggtaatcagact
ggactctatgtacttcgatgcagtcccaaggactttcataaatattttctgacttttgct
gttgagcgagagaatgttattgaatataagcactgtttgattacaaaaaatgagaatgga
gaatacaacctcagtggtactaagaagaacttcagtaatcttaaagatcttctgaattgc
taccagatggaaactgttcgctcggacagtataattttccagtttactaaatgctgtccc
ccaaagccaaaagacaaatcaaaccttctagtcttcagaaccagtggtgtttctgatgta
ccaacctcaccagctttacaaaggcataataatgtgaaccaaatggtgttccacaaaatt
agaaatgaagatttggtatttaatgaaagccttggccaaggaacttttacaaaaattttt
aaaggtataagaagagaaataggagactatggtcagctgcatgaaacagaagttctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatg
atgagccagctttctcacaaacatctgattttaaattatggagtatgtgtctgtggagag
gagaacattctggttcaggaatttgtaaaatttggatcactagatacatatctgaaaaag
aataaaaattctataaatatattatggaaacttgaagtggctaaacagttggcatgggcc
atgcattttctagaagaaaaaacccttattcatgggaatgtgtgcgccaaaaatgttctt
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaagacatcctgcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatctaaacctggcaacagacaaatggagttttggt
accacattgtgggaaatctgtagtggaggagataagccgctgagtgctttggattctcaa
agaaaactacaattttatgaagataggcaccagcttcctgcaccaaagtggacagaatta
gcaaatcttattaataattgcatggattatgaaccagattttagaccttctttcagagcc
attataagagatcttaatagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgagaataggtgccctaggattttctggtgcttttgaagaccgagac
cctacacaatttgaagaaagacacttgaaatttctacagcaacttggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaagacaatactggggaggtggtggct
gtgaaaaagctccagcacagtactgaagagcacctcagagactttgaaagagaaattgaa
atccttaaatccttgcagcatgacaacattgtaaagtacaaaggagtctgctacagtgct
ggccggcataatctaagattaattatggagtatttaccatatggaagtttacgagactat
ctccaaaaacataaagaacggatagatcataaaaaacttctgcagtacacatctcagata
tgcaagggcatggaatatcttggtacaaaaaggtatatccacagggatctggcgacaagg
aatatattagtggagaatgaaaacagagttaaaataggagattttggattaaccaaagtc
ttgccacaagacaaagagtactacaaagtgaaagagcctggtgaaagtcccatattctgg
tatgcaccagaatcactgacagagagcaagttttctgtggcttcagatgtttggagcttt
ggagtggttctctatgaacttttcacatatattgagaagagtaaaagcccaccagcggaa
tttatgcgtatgattggcaatgacaaacaaggacagatgatcgtgtttcatttgatagaa
ctcctgaagaataatggaagattaccgagaccagatggatgcccagatgagatttacatg
attatgacagaatgctggaacaataatgtaaaccagcgcccctctttcagagacctagca
gttcgagttgatcaaataagggacaacatgactggatga

KEGG   Capra hircus (goat): 102182846
Entry
102182846         CDS       T02910                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04621  NOD-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05212  Pancreatic cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102182846 (JAK1)
   04151 PI3K-Akt signaling pathway
    102182846 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102182846 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102182846 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102182846 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102182846 (JAK1)
   04659 Th17 cell differentiation
    102182846 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102182846 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102182846 (JAK1)
   05203 Viral carcinogenesis
    102182846 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102182846 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102182846 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102182846 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102182846 (JAK1)
   05161 Hepatitis B
    102182846 (JAK1)
   05160 Hepatitis C
    102182846 (JAK1)
   05171 Coronavirus disease - COVID-19
    102182846 (JAK1)
   05164 Influenza A
    102182846 (JAK1)
   05162 Measles
    102182846 (JAK1)
   05168 Herpes simplex virus 1 infection
    102182846 (JAK1)
   05163 Human cytomegalovirus infection
    102182846 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102182846 (JAK1)
   05169 Epstein-Barr virus infection
    102182846 (JAK1)
   05165 Human papillomavirus infection
    102182846 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102182846 (JAK1)
   05140 Leishmaniasis
    102182846 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102182846 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102182846 (JAK1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102182846 (JAK1)
Protein kinases [BR:chx01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102182846 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 RIO1
Other DBs
NCBI-GeneID: 102182846
NCBI-ProteinID: XP_017900620
UniProt: A0A452EDI9
LinkDB
Position
3
AA seq 1159 aa
MQYLNIKEDCSAMAFCAKMRSSKKAEMNLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKVQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHPNDSGNVLCYEVMVTGNLGIQWRQKPHIVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CSEKSEVLGIQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDITQGEHLGRGTRTHIYSGT
LTDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLRQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQHMRKCWEFQPSNRTT
FQNLIEGFEALLRSMSNNS
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgcagtatctaaacataaaagaggactgcagtgccatggctttctgtgctaaaatgagg
agctccaagaaggcggagatgaatctggaggcccctgagccgggggtggaggtgctcttc
tacctgtcggatagggagcctctccggctgggcggcggagagtacacagcggaggagctg
tgcatccgggcggcgcaggagtgctgtatctctcctctgtgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccgaatcgcaccatcaccgtcgatgacaaa
acatcactccggctccactaccggatgaggttctatttcaccaactggcatgggaccaat
gacaacgaacagtcagtatggcgacattctccaaagaagcagaaaaatggctatgagaaa
aaaaaagttccagatgcaacacctctccttgacgccagctcactggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacggagcag
gatgggcatgacattgagaacgagtgtctggggatggccgtgctggccatctcccactat
gccatgatgaagaaggtgcaattgccagaactccccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataacgttttcaaggatttcctaaaggagtttaacaacaagaccatttgcgacagcagc
gtgtccacgcacgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
tggttccatccaaatgatagtggaaatgttctctgctatgaagtgatggtgactggaaac
ctggggatccagtggagacagaaaccacatattgttcctgttgaaaaggaaaaaaacaaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggaaaaaaacaaaatccga
gaagagtggaacaatttttcttacttccctgagatcactcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctcttcccacgag
gaggccttgtccttcgtgtccctggtggatggctacttccggctcacggcagatgcccat
cactacctctgcactgacgtggctcccccattgatcgtccacaacatacagaatggctgt
catggtccaatctgcacggagtatgccatcaataagctgcggcaggaggggagcgaggag
gggatgtacgtgctgcggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctctgaaaagtctgaggtgctgggtatccagaaacagttcaagaactttcagatcgag
gtgcagaagggccgctacagcctgcatggctcggaccgcagcttcccaagccttggggac
ctcatgagccacctaaagaagcagatcctgcgcacggacaacatcagctttgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccaccaagaaagcc
caggagtggcagcctgtctaccccatgagccagctgagtttcgatcgaatcctcaagaaa
gatattacccaaggcgagcacctcgggagaggcacgcggacacacatctactctgggacc
ctcacggattacaaggatgacgaagggacttctgaagagaagagaataaaagtcatcctg
aaggtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgaggcaggtctcccataaacacatcgtgtacctctatggggtctgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggaggggggacccctggatctcttcatgcatcgg
aaaagtgatgtcctcaccacaccctggaagtttaaagttgccaaacagctggccagcgcc
ctgagttacttggaggataaagacctggtccatggaaacgtgtgcaccaaaaacctcctt
ctggcccgtgagggcatcgacagtgagtgcggccccttcatcaagctcagtgaccctggc
atccccatcactgtgctctccaggcaagagtgcatagaacgaatcccctggatcgctcct
gagtgtgttgaagactccaagaacctgagtgtggctgcggacaagtggagctttggaacc
acactctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgattgaa
aaagagagattctacgaaagccgttgcaggccagtgactccgtcttgtaaggagctagct
gacttgatgacccgctgcatgaactacgaccccaaccagagacccttcttccgagccatc
atgagagacatcaacaagctggaggagcagaatccagacattgtatcagaaaaaaagcca
acaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaggtcgagctctgcaggtatgaccctgagggggacaataca
ggggagcaggtggctgtcaaatccctgaagcccgagagtggagggaaccacattgctgat
ctgaagaaggagattgaaatcttaagaaatctttatcatgagaacatcgtgaagtataaa
ggcatctgcacagaagacggtggaaatggtattaagctcatcatggagtttctgccttca
gggagccttaaggaatatcttccaaagaataagaacaaaattaacctcagacagcaatta
aaatatgctgttcagatttgtaaggggatggactatttgggttctcggcaatacgttcac
cgggacttagcagcaagaaacgtccttgttgagagtgaacaccaagtgaaaattggggac
tttggtctaaccaaagccatcgaaactgataaggagtactacacagtcaaggacgaccgg
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaagttttatatcgcc
tccgatgtctggtctttcggagtaactctgcatgagctgcttacttactgtgattcagat
tccagtcccatggccttgttcctgaaaatgataggcccaactcatggtcagatgacggta
acaagactcgtgaatacattaaaagaaggaaaacgcttgccatgtccacctaactgtcca
gatgaggtttatcaacatatgcgaaagtgttgggaatttcaaccatctaatcggacaacc
tttcagaaccttatcgaaggatttgaagcacttctaagaagcatgagtaataacagttaa

DBGET integrated database retrieval system