KEGG   Capra hircus (goat): 102180726Help
Entry
102180726         CDS       T02910                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
chx  Capra hircus (goat)
Pathway
chx00052  Galactose metabolism
chx00500  Starch and sucrose metabolism
chx01100  Metabolic pathways
chx04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102180726 (MGAM2)
   00500 Starch and sucrose metabolism
    102180726 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102180726 (MGAM2)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102180726 (MGAM2)
    3.2.1.20  alpha-glucosidase
     102180726 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102180726
NCBI-ProteinID: XP_017902976
LinkDB All DBs
Position
4
AA seq 2905 aa AA seqDB search
MARKLSALEILLIIFIIIVLAVDILLLMLLLEKPSGASFVPECPEIPESERIDCAPGQEV
TEDVCRQKYKCCWKPVPNTAIPWCFFPRNWGYEISYWVNNTSTGYAARLRRLPSPSLFGY
DVTDTLFTAEPQTSNRFHFKITDFNNMRYEVPHENVKLFDGNADASTLSYHLEVSYKPFS
IKIMRTSNKRVLLDTSIGPLQFAQQYLQLSMRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRNYGGIDGLKNVVNRTREAEI
PYDVQYSDIDYMDEKKGFTIDGVAFHGLSDFAKELHQNGLKYVIIMNPGILNNSDYQPYV
NGSRKGVWILGNKGFAVGQAYPGWTVFPDFTNSDCTEWWKEQFSEFYKTLEFDGVWIEMD
EVSSFLQSSDQDCELNNFNFPPFKPRVLDHLLFARTLCMDTEFREGLHYDVHSLYGYTMA
RATDAAMETIFPKKRHFILSRSTFAGSGKFAAHWLGDNAARWDDLRWSIPGILEFNLFGI
PMVGANICGYTENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNAMLLESSR
YYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPALLITPVL
YEGLNYARAYIPDAIWYDYETQVAIEWRKQFVELLLPGDRIGLHLRGGYIFPIQRPNTTT
EASRKNSLGLIIALDSKREANGELYWDDGVSKDAVTENNYILYNFSITSNRLQATIIHAN
YTDPDKLTFTDIMILGMDKEPTNFTVSLNDATTSISNVVYTESTKVVNITDLKGLVLGQA
FSIQWDLPVSDLQKFNCFPEQPAVSEESCRERGCLWEPTTVPGVPTCFYDTIPSYAASNI
QYLPTGITVDLTHLTASEAAEATAASASDTLSATIGFLRLSVIYHTENMLQFKIYDPTNK
RYEVPVPLNTPSSPVGSPENCLYDVKIRNNPFGIQIRRKSSSTVIWDSQLPGFTFRDMFL
SISTRLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPAYKKNSYGVHPYYMALEEDG
SAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMIP
YWALGFHLSRYGYQDDYEIASLYVAMTAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGL
LIEQMKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKWPDNSDIVWGKVLPDLPNV
NVDGSLDLETQVKLYKAHVAFPDFLRNSTAAWWKREIEELYRNPREPEKSLKFDGLWINM
NEPSNFVNGSVTGCRNEILNNPPYVPYLEARDQGLSSQTLCMESQQVLPDGSPARHYDVH
SLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLKKSIVGMM
ECSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWDSNFE
MFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEERTTWDIDHQFMLGPAILI
SPVLENNTFQVQAYFPRARWYDYSTGSGNESRGEWKVLEAPLDHINVHVRGGYILPWQEP
AMNTHSSRKKYMGLIVALDDNGRAEGQLFWDDGQSIDTFENGNYFLVNFTAAQSVLQIQM
IHNNYLSDTNSLKVGYISIWGINSTDITQVTVSYDNQQFMVMNFKSDPYNQTLNIQLTDK
IISLEKLTEVTWIHGGPIVSTTTMMSTFPMSSSHPSTASTTAATSVTTSSSASSGTGTGT
AESTSAALAMTTTPFPTTTQVSTSTAVPDTTIHFPSNTTTDSTNVTLPITTMPYPTSTAE
FSASTSVPNATIPSPINTTTDGTNVTFTITTMPYPTNATEVSTSTTIPNATTSFPITTTT
DSTDITLPITDMPYSTSITDVSTSTSVPNTTVSFPINTTTDSTDITPLPVTTMPYPTSTA
EVSTSTSVPNTTVSFPQNTTTDSTDITLPVTAMSYPTSTIDVSTSTTVPNTTISSPINTT
TDSTDITLPVTDTPYTTSATEVSTSTTVPDITISSPINTTADSTNITLLVTTMPYPTSTT
EVSTSTTVLNTTISSPMNATTNSTNDPFPVTTMPFPTSATEVSTSTTVPNTTLSSPVNTA
TTDSTHITLPVTAMPSYTTSTTEVSTSTAVPNTTISSPINTTTDSTNVPLPVTTMPYPTS
ATEVTTSTTVPNTTISSPINITTDSTDITLPVTDMPYTTSATQVSISTTVPNATIPSPIN
TTTDSTITLPITDMPYTTSATQVSASTTASNNTTISSPINITTDSTNVPLPVTTMPYPTS
TAEVSTSTSVPNTTVSFPKNTTTDSTDITLPVTAMSCPTSTIDVSTSTTVPNTTISSPIN
TTTDSTDITLPVTAMPYPTSTTDVSTSTTLSNTTISSPINITTDSTNVPLPVTTMPYPTS
TAEVSTSTSVPNATLSSPVDTTTDSTDITLPITATPYPTSTTDASTSTTVPNTTISSPIN
ITTDSTNVPLPVTTVPYPTSATEVSTSTTVPNATLSSPVDTTTDSTDITLPVTDTPYTTS
ATEVSTSTTILNTTISSPINTTTDSTNVPLPVTTMPFPTSTTEVSTSTTVLNTTVSSPMN
ATTDDSTNVPLPVTTMPYPTSATDVSTSTSVPNTTISSPKYTTTDSTDITLPVTATSYPT
SATDVTTSTTVPNTTMSSPINITTDSTNVPLPVTTMPYPTSATEVTTSTTVPNATLSSPV
DTTTDSTDITLPITDTPYTTSATEVSTSTTVPDITIFSPINTTADSTNVPLPVTTMPFPT
SSTEVSASTTVSNTTISSPANTTRV
NT seq 8718 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagcttagtgcattggaaattcttctgatcatcttcatcataattgtactt
gctgtagatatcctcttgttgatgcttctgttggagaagccttcaggcgcttcatttgtt
ccagagtgcccagaaatccctgaatcagaaaggatagactgtgcccctggccaggaggtg
acagaggatgtctgcagacagaaatataagtgctgctggaaacctgtgccaaatactgcc
atcccctggtgcttcttccccaggaactggggctacgaaatcagctattgggttaacaat
acaagcacagggtatgctgcccggttgagaaggttgccatcaccatctctgtttgggtac
gacgtaaccgacaccctcttcacagctgaacctcagacatccaatcgtttccattttaag
atcactgatttcaataacatgcgctatgaagtcccccatgaaaatgttaagctctttgat
gggaatgctgatgcttccactttgagctatcatctagaagtcagttacaaacccttcagc
atcaaaataatgaggaccagcaacaaaagagtcttgttggacaccagcattgggcccctc
cagtttgcccagcagtacctgcagctctccatgcgactgcccagtgccaacgtgtatggg
ctgggtgaacacgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgggacgccacccctaccgagggcatgattaatctatatggagctcacacgttc
ttcttgtgcctagaagacaccagcggcttctctttcggggtttttctgatgaacagtaat
gccatggaggtcacccttcagcccgctcctgccgtcacttaccgcacgatcgggggtatc
cttgacttctatgtgttcctgggaaatactccagaacaagtggttcaggaatacctggag
cttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcagg
aattatggtggcattgatggattgaaaaatgttgtaaaccgaactcgtgaagctgagatc
ccatatgatgtccagtactctgacatagactacatggatgaaaagaagggtttcactatt
gacggagtggctttccatggtctctcagattttgccaaagagttacatcaaaatggactg
aaatatgtaattattatgaatcctggcatcttaaataactctgactaccagccttatgtg
aatggaagcagaaagggagtgtggatcttggggaacaaaggctttgctgttgggcaggca
tatcctggttggacagtttttcctgattttactaattcagattgtactgagtggtggaaa
gagcagttcagtgaattttataaaactctggagtttgatggagtgtggattgaaatggat
gaagtatctagctttctacaaagttctgatcaagactgtgaactaaacaacttcaacttt
cctcctttcaaacctcgagttctggaccacttgcttttcgcaagaaccctctgcatggac
acagagtttcgtgagggccttcactacgatgtccacagcttgtatggctacaccatggca
agagccacggacgcggccatggagactatcttccccaaaaagagacacttcatcttatca
cgttctacttttgcgggatctggcaaatttgctgctcattggttgggggacaatgcagcc
agatgggacgatctccgatggtccatccctgggatcctggagttcaacctattcggcatc
cccatggtaggtgccaacatctgtggttatacagagaatgtcacagaggagctctgcaga
cggtggatgcagctgggagcattttatccactgtcgaggaatcacaacgggcctgggttc
agggaccaggatcctgctgccttcagtgaaaacaacgctatgctattggaatcctccaga
tactatctgaacatccgctacaccctgctgccctatctctacacccttttctaccgagct
cataccctgggcgagaccgtagcaaggcccctcgtccacgagttctaccaggacccagcc
acctgggaggtgcacgagcagttcctctgggggcctgcactcctcatcacgcctgtttta
tatgaaggtttgaactatgcaagagcatacatacccgacgccatctggtacgactatgaa
acgcaagtagccatagaatggaggaaacaatttgtggagctgctgctgccaggtgatagg
ataggacttcacctccgagggggctacatctttcccatccagcggccaaacacgaccaca
gaggccagccggaagaactctctgggactcatcattgccttggactctaagcgagaagca
aacggagagctgtactgggatgatggtgtctctaaagatgctgtaactgaaaataattat
attctgtacaatttttccatcacctctaaccgtctacaggcaacgattatacatgctaat
tatacagaccctgacaaactcacatttacagatatcatgatcttgggaatggacaaggaa
cctactaattttactgtctccctaaatgatgctaccacctccatttcaaacgttgtctac
acagaatcaacaaaggtggtgaacatcactgacctcaagggactggtactgggacaagca
ttctccattcagtgggatctgccggtcagtgacctgcagaagttcaactgctttcctgag
cagcccgctgtctccgaggagagttgcagggagcgggggtgcctttgggagcccacgacg
gttcctggggtgcccacctgtttctatgacaccatccccagttatgctgccagcaacatt
cagtacctgcctacgggcatcactgtagacctcacccacctgacagcctcggaagctgca
gaagctacggccgcctctgcctctgacactctctctgcaaccatcggctttcttcgcctg
agtgtgatctaccacacagagaacatgctgcagttcaagatctatgatcccactaataaa
aggtatgaggtcccagtgcctctgaacaccccttcatctccagtgggctcccctgaaaac
tgtctgtatgatgtcaagattcggaacaatccttttgggatccaaattcgaagaaaaagc
tccagcactgtgatttgggactctcagctccctggattcaccttcagggacatgttcctt
tccatctccacacgcctcccctctcagtacctctatggctttggggaaactgagcacaca
actttcagaagaaacataagctggcacacgtgggggatgtttgcccgagatgagccacca
gcgtataagaagaactcctatggtgtccacccctactatatggcactggaggaggatggc
agtgcccatggagtgctcctgctgaacagcaatgccatggatgtgacattccagcctact
cctgccctgacatatcgcaccacaggaggcattttggacttttatatggttttggggcca
acccctgagcttgtaactcagcaatacactgagttgattggtcggccagcaatgattccc
tattgggccttgggattccacctgagtcgctatggataccaggatgattatgaaatcgcc
agtttgtatgttgcaatgacggctgctcagattccctacgatgtccagcatgtagacatt
gactacatggaccggaagctggacttcaccctcagccccagctttcaaaatcttggtctc
ctgattgagcaaatgaagaaaaatggcacgagatttgttcttgttctggacccagccatt
tctggcaatgagacccagtatctcacattcaccagagggaaggaaagtgatgtgttcatc
aaatggccagacaacagcgatatcgtctggggaaaggttttgccagatctgcccaacgtg
aatgtggatgggtcccttgatcttgaaactcaggttaagctgtacaaagcccatgttgct
tttcctgacttcttgcggaacagcacagctgcctggtggaagagggaaatagaagagctc
tacagaaaccctcgagagccagagaagagcttgaagtttgatggactgtggattaacatg
aatgaaccatcgaactttgtgaatggatctgtcacgggctgcagaaatgaaattcttaat
aatccaccctatgtgccatacttggaggcccgggaccagggcctgagcagccagaccctg
tgcatggagagccagcaggtgctgcccgatggctcaccggcgcgccactacgacgtgcac
agcctttatggctgggcccagaccagacccacgtacgaagccgtgcaggaggtgacggga
cagcgagggatcgtcatcactcgctccactttcccctcttctggccgctggggaggacac
tggctgggtgacaacacggccgcgtgggaccagctgaagaagtcaatcgttggcatgatg
gaatgcagtctctttggaatctcctatacaggagcagacatctgtggattctttggagat
gctgagtatgagatgtgtgttcgctggatgcagctgggggcgttttatccattttccagg
aaccacaacacattcgggaccaggagacaagatcctgtggcctgggactcaaactttgag
atgttctcaagaaaagtccttcagaccagatatactctgctgccttacctctacactcta
atgcataaggctcatgctgagggcagcactgtggttcgaccccttctccatgagtttaca
gaggaacgcacaacatgggatatagaccatcagttcatgctgggccctgccatcttaatt
agccccgtgctggaaaataacacatttcaggtccaggcttactttcccagagcccgttgg
tatgactacagcacgggatcgggcaatgaatcaagaggtgagtggaaagtcctggaggct
cccttggaccatatcaacgttcatgtcagaggaggctacatcctgccttggcaagaacct
gcgatgaacactcactccagccgaaagaaatatatgggattgattgttgctttggatgac
aatgggagagctgaaggtcagctgttctgggatgatggacaaagcattgatacctttgaa
aatggaaactatttcttggtaaactttacagcagctcagagtgtactgcaaatccaaatg
atacataataattatttgagtgacactaattcactgaaagttggatatattagtatctgg
ggcataaactctactgatataacacaagtgactgtctcctatgacaatcaacaattcatg
gtgatgaatttcaagagtgacccttacaatcagacactaaatattcaattgactgacaag
attatcagcctggaaaagttaactgaggttacttggattcacggtggtcctatagtttct
acgacaactatgatgagtaccttcccaatgagctcttcacatccttccacagcttctact
actgctgctacttctgttaccaccagttcttctgcttcaagtggcactggtactggtacc
gctgagagcactagtgctgctctcgctatgacaaccactcctttcccaacaactactcaa
gtttcaactagtactgctgtccctgataccactatacatttccctagtaatactactact
gatagcactaatgttactcttcccatcacaaccatgccttacccaacaagtactgctgaa
ttttcagctagtacttctgtccctaatgccactataccttcccctataaatactactact
gatggcactaatgttacttttactatcacaacaatgccttacccaacaaatgctactgaa
gtttcaactagtactaccatccctaatgctactacatctttccctattactactactact
gatagcactgatattactcttcctatcacagacatgccttactcaacaagtattactgat
gtttcaactagcacttctgtccctaacaccactgtatctttccctataaatactactact
gatagcactgatatcactcctcttccagtcacaaccatgccttacccaacaagtactgct
gaagtttcaactagcacttctgtccctaacaccactgtatctttcccccaaaatactact
actgatagcactgatatcactcttccagtcacagccatgtcttacccaacaagtactatt
gatgtttcaactagtactactgtccctaacaccactatatcttcccctataaatactact
actgatagcactgatatcactcttcctgtcacagacacgccatacacaacaagtgctact
gaagtttcaactagtactactgtccctgatatcactatatcttccccaataaatactact
gctgatagcactaatattactctgctagtcacaaccatgccttacccaacaagtactact
gaagtttcaactagtactactgtccttaataccactatatcttcccctatgaatgctacc
accaatagcactaatgatccttttccagtcacaaccatgcctttcccaacaagtgctact
gaagtttcaactagtactactgtccctaataccactctctcttcccctgtaaatactgct
actactgatagtactcatatcactcttcctgtcacagccatgccttcttacacaacaagt
actactgaagtttcaactagtactgctgtccctaataccactatttcttccccaataaat
actaccactgatagtactaatgttcctcttccagttacaaccatgccttacccaacaagt
gctactgaagttacaactagtactactgtccctaataccactatttcttccccaataaat
attactactgatagcactgatatcactcttcctgtcacagacatgccatacacaacaagt
gctactcaagtttcaattagtactactgtccctaatgccactataccttcccctataaat
actactactgatagcactattactcttcctatcacggacatgccatacacaacaagtgct
actcaagtttcagctagtactactgcctctaataataccactatttcttccccaataaat
attactactgatagcactaatgttcctcttccagtcacaaccatgccttacccaacaagt
actgctgaagtttcaactagcacttctgtccctaacaccactgtatctttccccaaaaat
actactactgatagcactgatatcactcttccggtcacagccatgtcttgcccaacaagt
actattgatgtttcaactagtactactgtccctaacaccactatatcttcccctataaat
actactactgatagcactgatatcactcttccagtcacagccatgccttacccaacaagt
actactgatgtttcaactagtactactctctctaataccactatttcttccccaataaat
attaccactgatagcactaatgttcctcttccggtcacaaccatgccttacccaacaagt
actgctgaagtttcaactagcacttctgtccctaacgccactctctcttcccctgtagat
acaactactgatagcactgatatcactcttcctatcacagccacgccttacccaacaagt
actactgatgcttcaactagtactactgtccctaataccactatttcttccccaataaat
attactactgatagcactaatgttcctcttccagtcacaaccgtgccttatccaacaagt
gcgactgaagtttcaactagtactactgtccctaatgccactctctcttcccctgtagat
acaactactgatagcactgatatcactcttcctgtcacagacacgccatacacaacaagt
gctactgaagtttcaactagcactaccatccttaataccactatatcttccccaataaat
actaccactgatagtactaatgttcctcttccagtcacaaccatgcctttcccaacaagt
actactgaagtttcaactagtactactgtccttaataccactgtatcttcccctatgaat
gctaccactgatgatagcactaatgttcctcttccagtcacaaccatgccttacccaaca
agtgctactgatgtttcaactagcacttctgtccctaatactactatatcttcccctaag
tatactacaactgatagcactgatatcactcttccggtcacagccacgtcttacccaaca
agtgccactgatgttacaactagtactactgtccctaataccactatgtcttccccaata
aatattactactgatagtactaatgttcctcttccagtcacaaccatgccttacccaaca
agtgctactgaagttacaactagtactactgtccctaatgccactctctcttcccctgta
gatacaactactgatagcactgatatcactcttcctatcacggatacgccatacacaaca
agtgctactgaagtttcaactagtactactgtccctgatatcactatattttccccaata
aatactactgctgatagcactaatgttcctcttccagtcacaaccatgcctttcccaaca
agtagtactgaagtttcagctagtactactgtctctaatactactatatcttcccctgca
aacactactcgtgtctag

DBGET integrated database retrieval system