KEGG   Capra hircus (goat): 102180958
Entry
102180958         CDS       T02910                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04625  C-type lectin receptor signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04921  Oxytocin signaling pathway
chx05135  Yersinia infection
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102180958 (NFATC3)
   04310 Wnt signaling pathway
    102180958 (NFATC3)
   04022 cGMP-PKG signaling pathway
    102180958 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102180958 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102180958 (NFATC3)
   04660 T cell receptor signaling pathway
    102180958 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    102180958 (NFATC3)
   04659 Th17 cell differentiation
    102180958 (NFATC3)
   04662 B cell receptor signaling pathway
    102180958 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102180958 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    102180958 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102180958 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102180958 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102180958 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    102180958 (NFATC3)
   05161 Hepatitis B
    102180958 (NFATC3)
   05163 Human cytomegalovirus infection
    102180958 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102180958 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102180958 (NFATC3)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102180958 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 102180958
NCBI-ProteinID: XP_017917672
UniProt: A0A452FQ41
LinkDB
Position
18
AA seq 1073 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSPSFQLQGHKNYEGTCEIPESKYSPLSGPKPFECPSIQITSISPNC
HQEIDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYPGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVQGGSGLGSAIFPFQYCAETDIPLKTRKTSEDQALILPGKLELCSD
DQGNLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIKEKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVSSLPH
PAQTQRASSDTGHLHDSVLSAQRSLVCPIQQTYASMVTASHLPQLQCRDESAGKEQHMIS
SSVVHQPFQVTPTPPMGSSYQPMQTNVVFNGPTCLPINAASSQEFDPVLFQQDAALPNLI
NLGCQTPSSIPFNSSNSGSTGHLLAHTPHSVQTLPHLQTMGYHCSNTGQRSLSSPVADQV
TGQPSSQLQTMTYGPSHSGTAITASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASS
PSLATRMHSGQHSAQAQSTGQGGISAPSSLLCHSLCDPASFPPDEATVNIKPEPEEQEPN
FSTIGLQDITLDDVNEVIGRDMSQISVSQGTGASRQTPLPGPSSLDLGRSDGL
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgactttaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaggtcacaaaaactatgaaggaacttgtgaaattcctgaatctaaatacagcccatta
agtggtcccaaaccctttgagtgcccgagtattcaaattacatccatctctcctaactgt
catcaagaaattgatgctcatgaagatgacctacacataaatgacccagaaagggaatat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggaatct
tcccttagtcctagtcctgccagtagcatctcttctaggagctggttctcagatgcgtct
tcttgtgaatctctttcacatatttatgatgatgtggattcggagttgaatgaagctgct
gcccgatttactctcggatcccctctgacttctcctggtggctctccaggaggctgccct
ggagaagagtcctggcatcaacagtatggacttggacattccttgtcacctaggcaatct
ccttgccactctcctagatctagtatcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcctacttccccttgtgggaaacggcggcactctagtgctgag
gtttgttaccctgggtccctttcaccgcatcattcgcctgttccttctcctggtcactcc
cccaggggaagtgtaacagaagatacctggctcaatgcttctgtccagggtggatcaggc
cttggctctgcgatttttccatttcagtactgtgcagaaactgatattcctctgaaaaca
aggaagacttctgaagatcaagctctcatactaccaggaaaattagaactctgttcagat
gaccaagggaatctttcaccgtcgcgggaaacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggtcacacccctatatttcgcacatcttcattacctccacta
gactggcctttaccaactcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcaccgagcccattatgaaactgaaggtagccgaggagcagtaaaagcatctact
gggggacatcctgtggtgaagctcctgggctacagtgaaaagccaataaatctacagatg
tttattggaacagcagacgaccgatacttacggcctcatgcattttaccaggtgcatcga
atcactgggaagacagttgctactgcaagccaagagataataattgccagcacaaaggtt
ctggaaattccacttcttcctgaaaacaatatgtcagccagtattgactgtgccggtatt
ttgaaactccgaaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagttcgacttgtgtttcgtgtacacatcccacagcccaatggaaaagtcctt
tctctgcaaacagcttctatacctgttgaatgctctcagaggtctgcccaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtt
acgggatctaattttcttccagaatccaaaatcatctttcttgaaaaaggacaagatgga
cgacctcagtgggaagtagaagggaaaataatcaaggaaaaatgtcaaggggctcacatt
gtccttgaagtccctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaagcaagaacacagagaagagattgacttgtcttcagtttcatctttgcctcat
cctgcccagactcagagggcttcttcagatacaggacacctgcacgacagtgtactgtct
gcacagagaagcttggtttgtcccatccagcaaacatatgcatccatggtaaccgcatcc
catctgccacagctgcagtgtagggatgagagtgctggtaaagaacagcatatgatatct
tcttcagtcgtgcaccagccttttcaagtcacaccaacacctcctatggggtcttcctat
cagcctatgcaaactaatgttgtattcaatggaccaacgtgtcttcctattaatgctgcc
tctagtcaagaatttgatccagttttgtttcaacaggatgcagctcttcctaatttaata
aatcttggctgtcaaacaccatcatctataccttttaattcttcaaattcaggctcaaca
ggacatctcttagcccacacacctcattctgtgcagaccctgcctcatctgcagacaatg
ggataccattgttcaaacacaggacaaagatctctttcttctccagtggccgatcaggtc
acaggtcagccttcctctcagttacaaaccatgacgtatggtccttcacattcagggact
gctataaccgcttccccagcagcctctcatcccctggccagttcgccactttctgggcca
ccatctcctcagctgcagcctatgccttaccagtctcctagctcaggaactgcctcgtca
ccgtctctagccaccagaatgcattctggacagcactcagctcaagcacaaagtacaggc
cagggaggtatttctgcaccttcatccttattatgtcacagtttgtgtgatccagcttca
tttccacctgatgaggcaactgtgaacattaaacctgagcctgaagagcaggaacctaat
ttttctacaattggtctgcaggacatcactttagatgatgtgaacgaggtaattgggaga
gacatgtcccagatttccgtttcccaagggacaggggcgagcaggcagactcccctcccg
ggtcccagttccctggatttaggaagatccgacgggctctga

KEGG   Capra hircus (goat): 102184725
Entry
102184725         CDS       T02910                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
chx  Capra hircus (goat)
Pathway
chx04022  cGMP-PKG signaling pathway
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04625  C-type lectin receptor signaling pathway
chx04921  Oxytocin signaling pathway
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102184725 (NFATC4)
   04022 cGMP-PKG signaling pathway
    102184725 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102184725 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102184725 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102184725 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    102184725 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102184725 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    102184725 (NFATC4)
   05161 Hepatitis B
    102184725 (NFATC4)
   05163 Human cytomegalovirus infection
    102184725 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102184725 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102184725 (NFATC4)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102184725 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 102184725
NCBI-ProteinID: XP_017910136
UniProt: A0A452FWG5
LinkDB
Position
10
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGAGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGSSGGPGGGRVLECPSIRITS
ISPTPDPPAALEDNPDPWGEGSPRDYPPPEGFGGYREAGGQGGGPFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLVRDPGSPGPFDYVGAPSAESIPQKTRRTSSEQAVALPRSEEPAPCNGKLPSGAEE
AGAPPGGPRKEAAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGSGKVVSVQTASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQAYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDASLRGFPSASGPPFGSDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPETGGATGCARPPPV
SLLPRPFPSDPYGGRGSPFPLGLQFPPPSPFRPPLPSSPPLEGPFPPQGSVHPPPAEGYS
EVGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggcagcgagctgcgaggatgaggagctggagtttaagctggtgttcggggaggaa
aaggaggcccccccgctgggcgcgggtggggcgggggaagaactggactcagaggacgcc
ccaccatgctgccgtctggccctgggggagccccctccctatggcgctgctcccattggc
attccccggcctccaccccctcggcctggcatgcactccccaccaccccgcccggccccc
tcacctggcacttgggagagccagccagcccggtcagtgaggctgggggggccgggaggg
agctccggggggcctgggggaggccgtgttcttgagtgccccagcatccgcatcacctct
atctctcccactcctgacccaccagctgcgctggaggacaacccagatccctggggggaa
ggctcccccagggactaccccccaccggaaggctttggaggctaccgagaggcagggggg
cagggtgggggcccattcttcagtccgagcccaggcagcagcagcctgtcctcctggagc
ttcttttcggatgcctcggacgaggcagccttgtatgcggcctgtgatgaggtggagtct
gagctaaatgaggcagcctcccgctttggcctgggctccccactgccctcaccccgggcc
tccccgaggccgtggacccccgatgacccctggagcctatatggtccgagtcctggaggc
cgggggccagaggatagctggctactcctcagtgctcctgggcccaccccagcctcccca
cgacctgcctctccatgtggcaagaggcgctattccagctcaggaaccccatcttcggcc
tccccagctctgtcccgccgaggcagcctaggggaggaggggcctgaaccacctccacca
ccccccttgcctctggtccgggaccctggctcccctggcccctttgactatgtgggagcc
ccatcggccgaaagcatcccgcagaagacccggaggacttccagcgagcaagccgtggcc
ctgcctcggtctgaggagcctgccccgtgcaatgggaagctgccctcgggagcagaggag
gccggggctcctcctgggggtcctcggaaggaggcggctggcatggactacctggcggtg
ccttctccactggcgtggtccaaggcccggatcgggggacacagccccatcttcaggacc
tctgccctccccccgctcgactggcctttgcccagtcagtatgagcagctggagctgagg
atcgaggtacagcccagagcccaccacagggcccactatgagacagagggcagccgggga
gctgtcaaagcagcccctggtggtcaccctgtagtcaagctcctgggctacagcgagaag
cccctgaccctgcagatgttcatcggcaccgcggacgagaggaacctgcggccccatgct
ttctatcaggtgcaccgcatcaccggcaagatggtagccacggccagctatgaagcagta
gtcagtggcaccaaggtgctggagatgaccctgctccctgagaacaacatggcggccaac
attgactgtgccggaatcctgaagctgcggaactcagatatcgaactgcggaagggtgag
acggacatcgggcgcaagaacacacgcgtgcggctggtgttccgagtacacgtgccccaa
ggcagcgggaaggtggtctcggtgcagacagcgtcggtgcccatcgagtgctcccagcga
tcagctcaggagctgccccaggtggaggcctacagccccagtgcctgctctgtcagggga
ggggaggagctcgtgctaactggctccaacttcctgccagactccaaggtggtgttcatc
gagaggggccctgatggaaagttgcaatgggaggaggaggccacggtgaaccggctgcag
agcaatgaggtgactctgaccctgacggtccctgagtacagcaacaagcgcgtgtcccgg
ccggttcaggcctacttctatgtctccaatgggcggaggaagcgcagtcctacccagagt
ttcaagttcctgcctgtgatcttcaaggaggagcctctgccggatgcatctctccggggc
ttcccctcagcatcgggccccccctttggctctgacatggacttctcaccacccaggccc
ccctacccctcctatccccatgaagaccctgcttatgaaactccttacctgtcagaaggc
ttcagctatggcacgccccctctgtacccccagacggggcccccaccatcctacagaccc
ggcctgcggatgttccctgagactgggggtgccacaggttgtgcccgcccacctccagtc
tctctccttccccggcccttccctagtgacccctatggaggacggggctccccctttccc
ctggggctgcagttccctcctccctcccccttccggcccccactgccttcatccccacca
cttgaaggtcccttccctccccagggcagtgttcaccccccacctgctgagggatacagt
gaggtagggccaagctacggccctggggagggggctccggagcaggagaaatccaggggt
ggctacggcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcctccc
gcctga

KEGG   Capra hircus (goat): 102188180
Entry
102188180         CDS       T02910                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04380  Osteoclast differentiation
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04921  Oxytocin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05135  Yersinia infection
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102188180 (NFATC1)
   04310 Wnt signaling pathway
    102188180 (NFATC1)
   04024 cAMP signaling pathway
    102188180 (NFATC1)
   04022 cGMP-PKG signaling pathway
    102188180 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102188180 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102188180 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    102188180 (NFATC1)
   04660 T cell receptor signaling pathway
    102188180 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    102188180 (NFATC1)
   04659 Th17 cell differentiation
    102188180 (NFATC1)
   04662 B cell receptor signaling pathway
    102188180 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102188180 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102188180 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102188180 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102188180 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102188180 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102188180 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102188180 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    102188180 (NFATC1)
   05161 Hepatitis B
    102188180 (NFATC1)
   05163 Human cytomegalovirus infection
    102188180 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102188180 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102188180 (NFATC1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102188180 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 102188180
NCBI-ProteinID: XP_017895147
LinkDB
Position
24
AA seq 995 aa
MPSTSFPVPSKFPLGPPVAVGGSGETLGPSAPAGGTMKSAEEEHYGYATPGLGAGLPLSA
AHPSLPAPCHDLQSSAAGVSTVGYGGAVDSGPSGYFLSSGGIRPNGAPALESPRIEITSY
LGLHHSSSQFLHEVDVEDVLPKRSPSTATLNLPSLEAYRDPSCLSPASSLSSRSCNSEAS
SYESSFSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACGLLGSPRHSPSTSPRTSVT
EESWLGARTSRPSSPCNKRKYGLDGRQLSCSPHPSPTPSPQGSPRVSVTDDTWLGNTTQY
TSSAIVAAINALSTDSSLDLGDGVPVKARKTTLDHSPAVALKVEPAGEELGATPPRRGAQ
PEVLAAPPHIGKGAFCDQYLLVPQHPYPWARPRSPTPCASPSLPALDWQLPSHSGPYELR
IEVQPKSHHRAHYETEGSRGAVKASAGGHPSVQLHGYVESEPLTLQLFIGTADDRLLRPH
AFYQVHRITGKTVSTASHEAVVCSTKVLEIPLLPENSMRATIDCAGILKLRNSDIELRKG
ETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSAASGPVL
GGKRMVLSGHNFLQDSKVIFVEKAPDGHHIWEMEAKTEGDLCKPNSLVVEIPPFRNQRIT
SPVQVSFYVCNGKRKRSQYQHFTYLPANVPIIKTEPSDDYEPALTCGPMSQGLSPLPKPC
YGQPLALPPDPGACLMPGFPSRPQGSASPELHDLSCAPYGSATAGPGHSPLGLPRPVGGV
LASQEAPRPSGVPPGPPQPPPPTLLQPQVSPTSSGSCSPGRRPALCPHSPSSPLPPGTRE
PTHLQPCGPAHPCGTGHQQHQPLEVPSSEPAAARPPPPPEVREDSNRSLAPISVTVKREP
QELDPLDLDDGTSSLGECVPRRHRAGPGKVLVGGLMTPVSNAERAWHGWNNGLGHMEGVH
HTPAGGRGEQGPPRHVAPTPHGRCSFHTGRLHYLE
NT seq 2988 nt   +upstreamnt  +downstreamnt
atgccaagtaccagttttccagtcccttccaagtttccactcggccctccggttgcagtc
ggcgggagcggagaaactttggggccctcggcgcccgccggcggcaccatgaagtcggca
gaggaagagcactacggctacgccacccccggcctgggtgcaggcctgcccctctctgcg
gcacacccctcgctgcctgctccatgccacgacctgcagagctcggccgcgggcgtctcc
actgtggggtacggcggggcagtggacagcgggccctccggctacttcctgtcatcgggc
ggcatccggcccaacggggcaccggccttggagagcccgcgcatcgagatcacctcctac
ctggggctgcaccacagcagcagccagttcctgcatgaggtggacgtggaggacgtcctc
cccaagcggtccccgtccacggccacgctgaacctgcccagcctggaggcctaccgtgac
ccctcctgcctgagccccgccagcagcctgtcctcccgaagctgcaactctgaggcctca
tcctacgagtccagcttctcgtacccgtatgcgtccccgcagacatccccctggcagtcc
ccctgcgtgtctcccaagaccacagaccccgaggagggcttcccccgcggcctgggggcc
tgcggcctgctcgggtccccgcgacactcgccctccacctctccccgcaccagcgtcacc
gaggagagctggctgggggcccgcacgtccaggccctcatccccctgcaacaagcgcaaa
tacgggctcgatggccggcagctgtcctgctccccacacccctcgcccacgccgtccccg
cagggctcaccacgggtcagcgtcaccgacgacacctggctgggcaacaccacacagtac
accagctcggccatcgtggccgccatcaacgccctgagcactgacagcagcctggacctg
ggcgacggcgtcccggtcaaggcccgcaagaccacgctggaccactcgcccgcggtggcg
ctcaaggtggagccggcgggcgaggagctgggggccacgccgccccgccgtggcgcccag
ccggaggtgctcgcggcccccccgcacatcggcaagggcgccttctgcgaccagtacctg
ttggtgccgcagcacccttacccgtgggcccggccgcggtcccccacgccctgcgccagc
ccgtccctgccggctctcgactggcagctgccgtcacactcaggaccctacgagctgagg
atcgaggtgcagcccaagtcccaccaccgtgcccactacgagacggagggcagccgcggg
gctgtgaaggcgtcagccgggggccatcccagcgtgcagctacatggctacgtggagagc
gagccactgaccctgcagctcttcatcggcacggcggacgaccggctgctgaggccacac
gcgttctaccaggtgcatcggatcacgggcaagaccgtgtccaccgccagccacgaggcc
gttgtctgcagcaccaaggtcctggagatcccgctgctgccggagaacagcatgcgcgcc
accatcgactgtgctgggatcctgaagctcaggaactccgacattgagctgcgcaagggg
gagacggacattgggagaaagaacacgcgggtgcggctggtcttccgcgtccacatcccg
cagcccaacggccggacgctgtcgctgcaggtggcctccaaccccatcgagtgctcccag
cgctcggcccaggagctgcccctcgtggagaagcagagtgcggccagcggccccgtcctc
ggagggaagaggatggtcctctccggccacaactttcttcaggactccaaggtcattttt
gtggagaaagcaccagatggccaccacatctgggagatggaggcaaagactgaaggagac
ctgtgcaagccgaactcgctggtggtggagatcccgcctttccgcaaccagaggataacc
agccctgtgcaggtcagcttctatgtctgcaacgggaagaggaagcggagtcagtaccag
cacttcacctacctgcccgccaacgttccaatcataaaaacggagcccagcgatgattac
gagcctgccctcacctgtggaccaatgagccagggcttgagcccgctccccaagccttgc
tacggccagccgctcgccctgccgcccgacccgggtgcctgcctcatgcccggcttccca
tcccgtccgcagggcagtgccagccccgagctccacgacctctcctgtgccccttatggc
tcggccacggctggcccgggccacagccccctcggacttccgcggccagtcggcggggtc
ctcgccagccaggaggcgccgagaccctcgggcgtgcctcctgggcccccccagccgccg
ccccccactctgctgcagccacaggtgagtccgacgtcgagcggtagctgctccccgggg
cgccggccagcgctctgtccccacagcccctcctctccgctgccgcccgggacccgagag
ccgacccacctgcagccctgtggcccagcgcacccctgcgggacgggccaccagcagcac
cagccactcgaggttccgagcagtgagcctgccgccgcccggcccccgccgccgcccgag
gtgcgtgaggacagtaatcgtagtctggcccccatttccgtaacggtcaagcgagagcct
caggagctggacccgctcgacctggatgacggaacttcatcactgggggaatgtgtcccc
cggcggcacagagcaggccctggaaaagtgcttgtcggtggtttaatgaccccagtgagc
aacgcggagcgagcttggcacgggtggaataatggcctgggccacatggaaggcgtccac
cacacaccagcaggaggccggggcgagcagggacccccccgtcacgtggcccccactccc
cacggacgctgcagtttccacacgggccgtttgcattatttggagtag

DBGET integrated database retrieval system