KEGG   Capra hircus (goat): 102181169
Entry
102181169         CDS       T02910                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
chx  Capra hircus (goat)
Pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04144  Endocytosis
chx04150  mTOR signaling pathway
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04350  TGF-beta signaling pathway
chx04360  Axon guidance
chx04510  Focal adhesion
chx04520  Adherens junction
chx04530  Tight junction
chx04611  Platelet activation
chx04621  NOD-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04660  T cell receptor signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04972  Pancreatic secretion
chx05100  Bacterial invasion of epithelial cells
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05152  Tuberculosis
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102181169 (RHOA)
   04015 Rap1 signaling pathway
    102181169 (RHOA)
   04310 Wnt signaling pathway
    102181169 (RHOA)
   04350 TGF-beta signaling pathway
    102181169 (RHOA)
   04072 Phospholipase D signaling pathway
    102181169 (RHOA)
   04071 Sphingolipid signaling pathway
    102181169 (RHOA)
   04024 cAMP signaling pathway
    102181169 (RHOA)
   04022 cGMP-PKG signaling pathway
    102181169 (RHOA)
   04150 mTOR signaling pathway
    102181169 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102181169 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102181169 (RHOA)
   04520 Adherens junction
    102181169 (RHOA)
   04530 Tight junction
    102181169 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102181169 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102181169 (RHOA)
   04621 NOD-like receptor signaling pathway
    102181169 (RHOA)
   04625 C-type lectin receptor signaling pathway
    102181169 (RHOA)
   04660 T cell receptor signaling pathway
    102181169 (RHOA)
   04670 Leukocyte transendothelial migration
    102181169 (RHOA)
   04062 Chemokine signaling pathway
    102181169 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102181169 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    102181169 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102181169 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    102181169 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102181169 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    102181169 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102181169 (RHOA)
   05206 MicroRNAs in cancer
    102181169 (RHOA)
   05205 Proteoglycans in cancer
    102181169 (RHOA)
   05203 Viral carcinogenesis
    102181169 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102181169 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102181169 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102181169 (RHOA)
   05135 Yersinia infection
    102181169 (RHOA)
   05133 Pertussis
    102181169 (RHOA)
   05152 Tuberculosis
    102181169 (RHOA)
   05100 Bacterial invasion of epithelial cells
    102181169 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102181169 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102181169 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102181169 (RHOA)
   04031 GTP-binding proteins [BR:chx04031]
    102181169 (RHOA)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    102181169 (RHOA)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102181169 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   102181169 (RHOA)
  Exosomal proteins of colorectal cancer cells
   102181169 (RHOA)
  Exosomal proteins of bladder cancer cells
   102181169 (RHOA)
GTP-binding proteins [BR:chx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    102181169 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 102181169
NCBI-ProteinID: NP_001273372
UniProt: I1VE57
LinkDB
Position
22
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc
ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag
aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa
cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system