KEGG   Capra hircus (goat): 102181392Help
Entry
102181392         CDS       T02910                                 

Gene name
NKX3-1
Definition
(RefSeq) NK3 homeobox 1
  KO
K09348  homeobox protein Nkx-3.1
Organism
chx  Capra hircus (goat)
Pathway
chx05200  Pathways in cancer
chx05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102181392 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102181392 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102181392 (NKX3-1)
Transcription factors [BR:chx03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    102181392 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez
Motif
Other DBs
NCBI-GeneID: 102181392
NCBI-ProteinID: XP_013821542
LinkDB All DBs
Position
8
AA seq 246 aa AA seqDB search
MLRTPEPRPGNAGAVGCSPHAVPPTQTKPLTSFFIQDILWDGADRRGGHAGSPQPQPSRQ
PSRLYPRRDPKPEPEGGRGGARAPEDQQGDQTRAGSEEAEKPVETEPDGHLETYLLDCEN
PPSTLQSLPPATKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQV
KIWFQNRRYKTKRKQLTSDLGTLEKHSSLPALKEEGFSQGSLISVHNTYPYYPYVYCLGG
WSPAFW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctccggactccggagccacggcccgggaacgcgggggccgtaggctgcagtccccat
gctgtgccgcccacccagaccaagccgctcacctccttcttcatccaggacatcctttgg
gacggcgctgaccggcgcggaggtcacgcgggcagtccacagccgcagccttcgcgtcag
ccttctcgcctctacccgaggcgagacccgaagccggagcccgagggaggaagaggcggc
gcccgggcgccggaggaccagcagggcgaccagacccgcgccgggagcgaggaggccgag
aaaccggtggagaccgagccagatgggcacttagagacttatctgctggactgtgaaaac
cctcccagcaccttacagagcctacccccagccaccaaacagcctcagaagcgctcccgg
gctgccttctctcacactcaggtcattgagttggagaggaaattcagccatcagaagtat
ctgtcggcccccgaaagggctcacctggccaagaacctcaagctcacggagacccaagtg
aaaatatggttccagaacagacgctataagaccaagcggaagcagctcacctcggacctg
ggcaccctggagaagcactcttccttgccagctctcaaagaggagggcttctcacagggc
tccctcatctccgtgcacaatacctacccttactacccctacgtttactgcctgggtggc
tggagcccagctttctggtaa

DBGET integrated database retrieval system