KEGG   Capra hircus (goat): 102181454
Entry
102181454         CDS       T02910                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
chx  Capra hircus (goat)
Pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04510  Focal adhesion
chx04611  Platelet activation
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102181454 (MYLK4)
   04020 Calcium signaling pathway
    102181454 (MYLK4)
   04022 cGMP-PKG signaling pathway
    102181454 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102181454 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102181454 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102181454 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102181454 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102181454 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    102181454 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102181454 (MYLK4)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     102181454 (MYLK4)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   102181454 (MYLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Choline_kinase Kinase-like APH
Other DBs
NCBI-GeneID: 102181454
NCBI-ProteinID: XP_017894748
LinkDB
Position
23
AA seq 526 aa
MEPSALKSPVSKINILPHLTKKATAEQHELKDYLSLNRGSKWHSRERLLPPGVDTCLFRR
LTLTARQDLCRGLSSRSELCELSFIYWNLCSRLGVVWTPACPHKCGEKSHADCVLIYKSE
TEGDRDHTPDTDFLGFPTKMLTVKRLGRSNACYHGDQLEKMALFQCMEEVEKCFLEESSG
EQDSRSGKNQAKEQAWSLPGLQETAPAAGERTAAPAADALAPPAPFDHRIVTARQAAINS
FYTVSRTEILGGGRFGQVHKCEEKATGLKLAAKIIKTRGVKDKDDVKNEISVMNQLDHVN
LIQLYDAFESKNDIVLVMEYVGGGELFDRIIDDNCSLTELDTILFIRQICEGIRHMHQMY
ILHLDLKPENILCVNRDTKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSF
PTDMWSVGVITYMLLSGLSPFLGDDDAETLNNILACRWDLEDQEFQDISEEAREFISKLL
IKEKSWRISASEALKHPWLADHKLHSRLSTQKRKNCCSDAQDLATK
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggagccatcggctttgaaaagcccagtgtctaaaattaatattcttccccatctgact
aagaaggcaacagctgagcaacatgagctcaaggactatctgagtttaaacaggggctca
aagtggcattcgagagagaggctacttcctcccggagtggacacttgtctcttcagaaga
cttactctgaccgcaaggcaagacctttgccgggggctgagcagtcgttctgaactctgc
gaactctcctttatctactggaacttgtgctcgaggcttggagtggtctggaccccagca
tgtcctcataaatgtggagagaagagtcacgctgactgtgtcctcatttacaaatcagag
accgagggggacagagaccacactccagacacggacttcctcggattccccaccaagatg
ctaacagtgaagaggctgggaagaagcaacgcgtgttaccacggtgaccagctggagaag
atggccttgttccagtgcatggaggaggtggagaagtgctttctggaagaaagttccggt
gaacaagattcgagatctggaaagaaccaggcgaaggagcaagcgtggtcactccctggc
ctgcaggagacagcacccgccgccggtgaaaggacagcggcccccgcagccgacgccctg
gcaccgcccgcgccctttgaccaccgcatcgtgacggccaggcaggccgccatcaacagc
ttctacaccgtgagcaggaccgagatcttgggaggcggacgcttcggccaagttcacaag
tgtgaggagaaggccacgggcttaaagctggcggccaagatcatcaagaccaggggcgtg
aaggacaaggacgatgtgaagaacgagatcagtgtcatgaaccagctggaccacgtgaac
ctcatccagctctacgacgccttcgagtctaagaacgacatcgtcctggtcatggaatac
gtgggcggtggtgagctcttcgaccgcatcatcgacgacaactgcagcctgaccgagctc
gacaccatcctgttcatcaggcagatatgcgaggggataagacacatgcaccagatgtac
atcctccacctggacctgaagcctgagaacatcctgtgtgtgaatcgagacactaaacaa
ataaaaattattgactttggattggccagaaggtacaaacccagagagaagctgaaggtg
aacttcggaacgccggagttccttgcccccgaagttgtaaactacgattttgtctccttc
cccactgacatgtggagtgtgggcgtcatcacctacatgctactcagcggcttgtccccc
ttcctgggcgatgacgatgccgaaaccctgaacaacatcctggcctgcaggtgggacctg
gaggaccaagagttccaggacatctcggaggaggcccgggagttcatctccaagcttctc
attaaggagaagagctggagaatcagtgctagtgaggctctcaagcacccttggctggcg
gaccacaagctccactccaggctcagcacgcagaaaaggaagaattgctgctctgatgcc
caggacctggcgaccaaatag

KEGG   Capra hircus (goat): 102181980
Entry
102181980         CDS       T02910                                 

Gene name
MYLK3
Definition
(RefSeq) myosin light chain kinase 3
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
chx  Capra hircus (goat)
Pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04510  Focal adhesion
chx04611  Platelet activation
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102181980 (MYLK3)
   04020 Calcium signaling pathway
    102181980 (MYLK3)
   04022 cGMP-PKG signaling pathway
    102181980 (MYLK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102181980 (MYLK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102181980 (MYLK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102181980 (MYLK3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102181980 (MYLK3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102181980 (MYLK3)
  09154 Digestive system
   04971 Gastric acid secretion
    102181980 (MYLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102181980 (MYLK3)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     102181980 (MYLK3)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   102181980 (MYLK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo DUF1128 APH
Other DBs
NCBI-GeneID: 102181980
NCBI-ProteinID: XP_017917466
UniProt: A0A452FA35
LinkDB
Position
18
AA seq 786 aa
MSGAPKESLGPQGLPGLGKACLTTMDKKLNMLNEKVDKLLHFQEDVTEKLQCVYRGMGHL
EQGLHRLEASRGLGLAGADRPPPSDAQAGWPEVLELVRAGRQDAAQQGARLEALFRMVMA
VDKAIALVGTVLQNSKVVDFIMQGSVPWRKGSLADVPEENKERVEEKEAKPKHTLSTRGV
QAELRGPWEESQKADLPEGTGSDLPTQAEAPPEQRDGISGPTQVRPEVEVQAPRASSENP
GIGLELSVVSERVSEAPTGQEAASSAARGTSPSRPDPRPSVEGMRLTPAPPAQAKAAHCG
GETPPRISIHVQETDTPGELLVTRGGSLRTSPPAETPAAVPPGEQDPPGPRCCPQVPGTE
SGKPILRGASVRKWSCDGGAKAKEKQGPGSELTMAPSRARRDKGVDSGAPGPQQDTNPEA
GNPDPGKDCTAEGAGRAEAGSRTPPGAEAGSLVLDDSPAPPAPFEHRVVSVRETSTSAGY
TVCQHEVLGGGRFGQVHRCTEKATGLSLAAKIIKVKSAKDREDVKNEINIMNQLSHVNLI
QLYDAFESKNSFTLVMEYVDGGELFDRITEEKYRLTELDVVLFTKQICEGVHYLHQHYVL
HLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPT
DMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCNWDFDADTFEGLSEEAKDFVSRLLVK
EKSCRMSATQCLKHEWLNNLPAKASKSKVHLKSQLLLQKYMAQRKWKKHFYVVTAANRLR
KFPTCP
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgtcaggagcccctaaggagagtttggggccccaggggctgccagggctgggcaaggcc
tgcttaaccaccatggacaaaaagctcaacatgctgaatgagaaggttgacaaactgtta
catttccaagaagacgtgacggagaaactgcagtgtgtgtaccgaggcatgggccacctg
gagcaaggcctgcaccggctagaggcctcccgcggtctgggcctggctggggccgaccgc
cccccgccgtctgatgctcaggctgggtggccggaggtcctggagctggtgcgggccggg
aggcaggatgccgcccagcagggcgccaggcttgaagccctcttccggatggtgatggct
gtggacaaggccattgccttggtggggaccgtgctccagaactcgaaggtggtggatttc
atcatgcaagggagtgtcccctggaggaagggaagcctggccgacgtccctgaggagaac
aaagagcgagtggaagagaaagaagcaaaaccaaagcacacgctgagcaccagaggtgta
caagctgagctcaggggcccttgggaagagagccagaaggcggacctgccagaagggaca
ggatctgaccttcctacccaggcagaggccccaccagagcagagagacggaatttctggc
ccaactcaggtgcgcccagaggtggaagtccaagctcctagagcatccagcgagaacccc
gggattggcctggaactgtctgtggtgtctgaaagggtcagtgaggctcccactgggcag
gaggctgcatcgagtgcagcacgaggaacatcacccagtaggcctgaccctcggccctcg
gtggagggcatgaggctgactccagcaccgccagctcaggccaaggcagctcactgtggt
ggagaaacacctccaaggatctccatccatgtgcaggagacagatacccctggggagctg
cttgtgacacgagggggcagcctcagaacctcaccccctgctgagactccagcagctgtg
cctccaggtgagcaggacccacctgggcccaggtgctgcccccaggtccctggaactgag
tcaggaaaacctatcctcagaggagccagtgtgagaaagtggagctgtgacgggggagca
aaggccaaagagaagcaaggacctgggtctgagctgaccatggcgccaagcagggccagg
agggacaagggagttgattccggggccccaggcccacagcaggacacaaacccagaagca
gggaaccctgaccctgggaaggactgcacggctgagggtgcaggcagagccgaagcagga
agcaggacacccccaggagctgaggcgggcagcctggttctagacgacagtccagccccg
ccagcccctttcgagcaccgggtagtgagtgtcagggagacctcgacctcagcgggctac
acagtgtgccagcatgaagtcctgggagggggccggtttggccaggttcacagatgcacg
gagaaggccacaggcctctcgctggcggccaagatcatcaaagtgaagagcgccaaggac
cgggaggatgtcaagaatgagattaacatcatgaaccagctcagccacgtgaacctgatc
cagctctacgacgcctttgagagcaagaacagctttaccctcgtcatggagtatgtggat
gggggtgagctctttgaccggatcacagaagagaagtaccgcctgactgaactggatgtg
gtcttgttcaccaagcagatctgcgagggtgtccattacctccatcagcattacgtcctg
cacttggacctcaagcctgagaacatactgtgtgtcaatcagacaggacaccaaattaag
atcattgactttgggctggccagaagatacaagcctcgggagaagctgaaagttaacttt
ggcactcctgagttcctggccccagaagtcgtcaattatgagtttgtctcgttcccgacg
gacatgtggagtgtgggagtcatcacctacatgctactcagtggtttgtccccatttcta
ggagaaacagacgcagagaccatgaatttcattgtgaactgcaactgggattttgatgct
gatacctttgaagggctgtcagaggaggccaaggactttgtctctcggttgctggtcaaa
gagaaaagctgcagaatgagtgccacacagtgcctgaaacatgagtggctgaataatttg
cctgctaaagcttcaaaatcgaaagttcatctcaaatcccaactattgctgcagaaatac
atggctcagaggaaatggaagaaacacttctatgtggtgactgctgccaacaggttaagg
aaatttccaacttgtccctaa

KEGG   Capra hircus (goat): 102182147
Entry
102182147         CDS       T02910                                 

Gene name
MYLK2
Definition
(RefSeq) myosin light chain kinase 2
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
chx  Capra hircus (goat)
Pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04510  Focal adhesion
chx04611  Platelet activation
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102182147 (MYLK2)
   04020 Calcium signaling pathway
    102182147 (MYLK2)
   04022 cGMP-PKG signaling pathway
    102182147 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102182147 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102182147 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102182147 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102182147 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102182147 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    102182147 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102182147 (MYLK2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     102182147 (MYLK2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   102182147 (MYLK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 102182147
NCBI-ProteinID: XP_005688421
UniProt: A0A452EYU2
LinkDB
Position
13
AA seq 632 aa
MATENGAVELEIPSSSTDAAPKGAAGEGPPAAEKDPGPPDPQKDPGPPDPQKDPGPPDPE
KDAGPPNPEKELGPPDPKKEPDPLNSTKDTEAPAPEKGDGASAQASTTSQGPEGEGGLQG
EPAEGSAGQLAALPQETATTKADIKKPEAEQKTPGSQDPGEGNLHKKVAEGQAASKKGAP
AFLHSPSCPAAISSLEKPLAEKPLDETSDLIFEGVPVTPGPTEREPAMVAEGEKNLPGGS
QKEEEKAAGQAGQAGVQGDTSRGIEFQAVPSERAEVGQALSPTAREEDCFQILDDCPPPP
APFPHRIVELRPGNINNQFSLNSKEALGGGKFGAVCTCTEKATGLKLAAKVIKKQTPKDK
EMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYQLTEVDTM
VFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFG
TPEFLSPEVVNYDQISDKTDMWSLGVITYMLLSGLSPFLGDDDTETLNNVLSSNWYFDEE
TFEAVSDEAKDFVSNLIVKDQRARMSAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKKYL
MKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggcgacggaaaacggagcagtggagctggaaatcccaagctcatcaacagacgcagca
ccaaagggtgcagcaggcgaaggacccccagctgcagagaaagaccctgggcccccagat
ccacagaaggatcctgggcccccagatccacagaaggatcctgggcccccagatccagag
aaggatgctggtcccccaaacccagagaaagaacttgggcccccagacccaaagaaagaa
cctgatcccctcaactcgacgaaagatactgaagccccggccccagagaaaggggatggg
gcctcggcccaagcctcaaccaccagccagggccctgagggagaaggaggcctgcaggga
gagcctgcggagggctctgctgggcagctggcagccctgccccaggagacagcaacaacc
aaggccgacatcaaaaagcccgaggctgagcagaagaccccgggcagccaggaccctgga
gaaggcaatttgcacaagaaggtagcagagggccaagcagcgagcaagaagggcgcaccc
gcctttctgcacagccccagctgccccgccgccatctcgagccttgagaagccactggcc
gagaagcccctagatgagacatcagacctcatctttgaaggggtgcctgtgacccctggt
cccacggaaagggagccagccatggtagctgaaggagagaagaacctcccgggaggcagc
cagaaggaagaagagaaggctgcaggccaggctggccaggctggggtgcaaggggacacc
tcgagaggaatcgaattccaggccgttccctcggagagagcagaggtggggcaggccctc
agtcccacagccagggaggaggactgcttccagattttggatgactgcccaccgccccca
gccccattcccccaccgcattgtggaactgaggcccgggaacatcaacaatcaattcagc
ctgaactccaaggaggcactgggcggcggcaagtttggagcggtctgtacctgcacagag
aaggccacaggcctcaagttggcagccaaggtcatcaagaaacagacacccaaagacaag
gaaatggtgttgctggagattgaagttatgaaccagctgaaccaccgcaacctgatccag
ctctatgcggccatcgagaccccgcatgagatagtcctcttcatggagtacatcgagggc
ggcgagctcttcgagaggattgtggacgaggactaccagctgactgaggtggacaccatg
gtgtttgtcaggcagatctgcgatggcatcctcttcatgcacaagatgagagttctgcat
ctggacctcaagccagagaacatcctgtgcgtcaacaccacgggccatttggtgaagatc
atcgactttggcctggcacggaggtataaccccaacgagaagctgaaggtgaattttggg
accccagagttcctatcccctgaggtggtgaattacgaccaaatctccgataagacagac
atgtggagcctgggggtcatcacctatatgctgctgagtggtctctcccccttcctggga
gacgatgacacagagaccctgaacaacgttctatcaagcaactggtactttgacgaggaa
acctttgaggccgtgtcagacgaggccaaagacttcgtctccaacctcatcgtcaaggac
cagcgggcccggatgagcgctgcccagtgcctcgcccacccctggctcaacaacctggca
gagaaggccaagcgctgtaaccgccgcctcaagtcccagatcttgcttaagaaatacctc
atgaagaggcgctggaagaaaaacttcattgctgtcagcgctgccaaccgcttcaagaag
atcagcagctcgggggcactcatggctctgggggtctga

KEGG   Capra hircus (goat): 102190641
Entry
102190641         CDS       T02910                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
chx  Capra hircus (goat)
Pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04510  Focal adhesion
chx04611  Platelet activation
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102190641 (MYLK)
   04020 Calcium signaling pathway
    102190641 (MYLK)
   04022 cGMP-PKG signaling pathway
    102190641 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102190641 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102190641 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102190641 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102190641 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102190641 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    102190641 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102190641 (MYLK)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     102190641 (MYLK)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   102190641 (MYLK)
SSDB
Motif
Pfam: I-set Ig_3 Pkinase ig Ig_2 23ISL V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Ig_6 Ig_4 BiPBP_C Kinase-like Kdo AvrM_N
Other DBs
NCBI-GeneID: 102190641
NCBI-ProteinID: XP_017901260
LinkDB
Position
1
AA seq 1937 aa
MGRFSCKITGRPQPQVTWLKGDVPLQPSARVSMSEKNGMQVLEIHDVTRDDVGVYTCMVV
NGSGKASMSAELSIQGLDNSNRSLVRGTKVAGTDIRKEVTQGSKPDGLAAAAENKNRPST
QRGGSPTWATGSQPQPPRESELEPLGDSPRKGQRAPVLQKTSSTITLQAAKVQLEPRAPV
PGTPCPSREEREEPAAAPPDTLPTRRSGLGSQDTMGKVATRKVPMESQRDTTFPKFENKP
QSQEVSEDQPVEFRCEVSGIPKPEVTWFLDGVPVRSREGRIEVYEAGGTHYLCLWRAQAQ
DSGSYSCTAANVRGQASCHWSLLVKQPAVVEVAPSFSSALKDCTVVEGQDFVLQCSVKGT
PLPRITWLLNGQPIQYARSTCEAGVAELHIQDTLPEDDGTYTCLAENTAGQVSCSARVTV
QEKKSEEKSECLLPAAPSKPTAPLFLQGLSDLHVMDGSQVTMTVRVSGNPPPEVIWLHDG
TEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPQDGTQ
PWFISKPRSVTACLGQSVLISCAIAGDPFPTVHWLRDGKALSRDTGHFEVLQNEDVFTLV
LKNAQPWHAGQYEILLKNRVGQCSCQVSLMLQSSPARVVLRGREPASCEGLCGRGAGADG
GGGGDGYGSLRPGWPVARGQGAPAEDDGEDVRGVLKRRVETRQHTEEAVRQQEVEQLDFR
DLLGKKVSTKTLSEEDLKEIPAEQLDFRDLLGKKVSTKTLSEEDLKEIPAEQMDFRANLQ
RQVKPKTLSEEERKVHGPQQVDFRSVLAKKGTPKTPVPEKVPPPKPATPDFRSVLGSKKK
LPTENGSNNAEALNAKAAEGPKPVGNAQPSGFLKPVGNAKLADTPKPLSSTKPAETPKPL
GNVKPAETPKPLGNVKPSETPKPLGNVKPAETPKPLGNVKPAETPKPLGNVKPAETPKPL
GNVKPAETPKPLGNVKPAETPKPLGNVKPAETPKPLGNVKPAETPKPVGNVKPAETPKPV
GNAKPAETPKPLSNVKPAETPKSVGNTKPAETSKPLDNTKPAEAPKPLGNAKPAEIPKPT
GKEELKKEVKNDVNCKKGHAGATDSEKRPESRGTAPTFEEKLQDLHVAEGQKLLLQCRVS
SDPPATVTWTLNGKTLKTTKFIVLSQEGSLCSVSIEKALPEDRGLYKCVAKNSAGQAESS
CQVTVDVPDAPASENAKAPEMKARRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQI
IQFPEDQKVRAGESVELFGKVAGTQPITCTWMKFRKQIQDSEHIKVENSEQGSKLTIRAA
RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGG
SAVQSYSVEIWDSVDKTWKELATCRSTSFNVQDLLPDREYKFRVRAINVYGTSEPSQESE
LTALGEKPEEEPKDEVEVSDDDEKEPEVDYRTVTVNTEQKVSDFYDIEERLGSGKFGQVF
RLVEKKTGKIWAGKFFKXYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLE
IVSGGELFERIIDEDFELTERECIKYMKQISEGVEYIHKQGIVHLDLKPENIMCVNKTGT
RIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLS
PFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLNCTQCLQHPWL
MKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTS
PLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPE
VVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV
ETMEEGEGEGGEEEEEE
NT seq 5814 nt   +upstreamnt  +downstreamnt
atggggcggttctcctgcaagatcactggccggccccagccacaggtcacctggctcaag
ggagatgttcccctgcagcccagtgctcgtgtgtctatgtccgagaagaacgggatgcaa
gtcctggaaatccacgacgtcacccgagatgacgtgggagtatacacgtgcatggtggtg
aacgggtcagggaaggcctccatgtctgctgagctctccatccaaggtttggacaattcc
aataggtcactcgtgagaggaacaaaggtggccggtacagacatcaggaaggaagtcact
caggggtccaaaccggatggcctggcagctgctgccgaaaataaaaaccgccccagcacc
cagcgaggaggctccccaacctgggccacagggagccagcctcaaccccccagggaatct
gagctggagccgctgggggactcccccagaaagggccagagggcccccgtcctgcagaag
acctccagcaccatcaccctgcaggcagcaaaagtccagctggagcccagagctccagtc
ccaggcaccccctgtccctccagagaagagagggaggagccagctgcggcccctccagac
accctccccaccaggcggtcaggcctgggaagccaggacaccatgggcaaggttgctacc
aggaaggtccccatggagagccagagggacaccacgtttcccaaatttgagaacaagccc
cagagccaggaggtcagtgaagatcagccagtcgagttcagatgcgaggtttcagggatc
cccaaacctgaagtgacctggttcctggacggtgtccctgtgaggagtcgagagggcaga
atcgaagtttacgaagctggggggacgcattacctctgcctgtggagagcccaggcccag
gacagcgggagctacagctgcacagccgccaatgtccgaggccaggcgtcctgtcactgg
agcctcctggtgaaacagccagccgtggtggaggtggccccatcattctccagtgccctg
aaggactgcactgttgttgaaggtcaggactttgtgctgcaatgctcagtgaaggggacc
ccattgcctcgaatcacttggctgctcaatggacagcccatccagtatgcccgctccacc
tgcgaggctggcgtggctgagctccacatccaggacaccctcccagaggacgatggcacc
tacacctgtctggccgagaacaccgcggggcaggtgtcctgcagcgcccgtgtcactgtc
caggagaagaagagtgaggagaagagcgagtgcctcctgcccgcggcccccagcaagccc
accgcgcccctcttcctgcagggcctctctgacctccacgtcatggacgggagccaggtc
accatgacagtccgggtgtcagggaacccgcccccggaggtcatctggcttcacgacggg
actgagatccaggagtccgaggacttccactttgaacagagaggcactcagcacagcctg
tgtatccaggaagtgttcccggaggacacgggcacttacacctgtgaggcctggaacagc
gcaggagaggtccgcacacaggctgtgctcactgtgcaagagccgcaggatggcacccag
ccctggttcatcagcaagccccgctcggtgactgcctgcctgggccagagtgtccttatc
tcctgtgccatagccggcgaccccttccccactgtgcactggctccgagatggcaaagcc
ctctccagagacactggccacttcgaggtgctacagaatgaggatgtgttcaccctggtt
ctgaaaaacgcgcagccctggcacgccggccagtatgagatcctgctcaagaaccgtgtt
ggccagtgcagttgccaggtgtccctgatgctacagagcagcccggccagagtggtcctg
cgggggagggagcctgccagctgcgagggcctctgtggccgaggagctggtgctgatggt
ggtggtggtggtgacggctacgggagcctgaggcctggctggccggtggcgagagggcag
ggtgcccccgcggaagacgacggcgaggacgtgcgtggggtgctcaagaggcgcgtggag
acacggcagcacacggaggaggccgttcgccagcaggaggtggagcagctggacttccgt
gacctcctgggcaagaaggtgagcaccaagaccttgtctgaagaggacctgaaggagatc
ccagctgagcagctggacttccgcgacctcctgggcaagaaggtgagtacaaagaccttg
tctgaagaggacctgaaggagatcccggctgagcagatggatttccgcgccaacctgcag
cggcaagtgaagccgaagaccctgtcggaggaggagaggaaagtgcatggcccccagcag
gtggacttccgctctgtcttggccaagaaggggactcccaagacccctgtgcctgagaag
gtaccccctccaaaacctgccaccccagattttcgctcagtgttgggcagtaagaaaaaa
ttaccaacagagaatggtagcaataatgctgaggccttgaatgccaaggcagcagaaggt
cccaagcctgtgggcaatgcccagccttcagggttcctgaaacctgtgggcaacgccaag
ctggctgatacccccaaacccttgagcagcaccaagccagcagagacccccaaacccttg
ggtaacgtcaagccagccgagacccccaaacccttaggtaacgtcaagccatcagagacc
cccaaacccttgggtaacgtcaagccagccgagacccccaaacccttgggtaacgtcaag
ccagccgagacccccaaacccttgggtaacgtcaagccagccgagacccccaaacccttg
ggtaacgtcaagccagccgagacccccaaacccttgggtaacgtcaagccagccgagacc
cccaaacccttgggtaacgtcaagccagccgagacccccaaacccttgggtaacgtcaag
ccagccgagacccccaaacccgtgggtaacgtcaagccagccgagacccccaaacctgtg
ggcaacgccaagccagccgagacccccaaacccttgagtaacgtcaagccagccgagacc
cccaaatctgtgggcaacaccaagccagctgagacctctaaacccttggataacaccaag
ccagctgaggcccctaaacccttgggcaatgccaagccagctgaaatcccaaaacccact
gggaaagaagaacttaagaaggaggttaagaatgatgtgaactgcaagaagggccatgca
ggggccacagacagtgaaaagagaccagagagccgagggacagccccgacctttgaggag
aaactacaagatctccatgtggcagagggtcagaagctgctgctccagtgcagggtgtcc
tctgaccccccggccaccgtcacttggacactgaatggaaagaccctcaagaccactaag
ttcatcgtcctctcccaagaaggctccttgtgctccgtctccatcgagaaggcactgccc
gaggacagaggcttgtacaagtgtgtagccaagaacagtgccggccaggctgagtcctcc
tgccaagtcaccgtggacgttccagatgcccccgccagcgaaaatgccaaggccccggag
atgaaagcccggaggccgaagagctctcttcctccagtgctaggaacagagagtgatgca
actgtgaaaaagaaacctgcccccaagacacctccgaaggcagccatgccgcctcagatc
atccagtttcctgaggaccagaaggtgcgggcaggagagtctgtggagctctttggtaag
gtggccggcacccagcccatcacctgcacctggatgaagttccgaaagcagatccaggac
agcgagcacatcaaggtggagaacagtgagcagggcagcaagctcaccatccgggcggcg
cgccaggagcactgcggctgctacaccctgctggtggagaacaaactgggcagcaggcag
gcccaggtcaacctcaccgtggtggataagccagaccccccagctggcacgccttgtgcc
tctgacatccgaagctcctcgctgaccttgtcctggtacggttcctcgtatgatgggggc
agcgccgtacagtcatacagtgtcgagatctgggactcagtggacaagacgtggaaggaa
ctagccacgtgccgcagcacttctttcaacgtccaggacctgctgcctgaccgagaatat
aagttccgtgtgcgtgcaatcaatgtctatggaaccagtgagccaagccaggagtctgaa
ctgacagccttgggagagaaacctgaagaagagccgaaggacgaagtggaggtgtcagat
gatgatgagaaggaacctgaggtcgactaccggaccgtcacggtcaataccgagcagaaa
gtgtccgacttctatgacatcgaagagagactaggatctgggaaatttggacaggtcttt
cgacttgtagaaaagaaaactggaaaaatctgggcagggaaattcttcaagngctattcg
gccaaggagaaagagaacatccgtcaggagatcagcatcatgaactgcctgcaccacccc
aagctggtccagtgtgtggacgcctttgaagagaaggccaatatcgtcatggtcctggag
atcgtgtccgggggcgagctgttcgagcgcatcattgatgaggacttcgagctgacggag
cgggagtgcatcaagtacatgaagcagatctcggagggggtggagtacatccacaagcag
ggcatcgtccacctggacctcaagcccgagaacatcatgtgtgtcaacaagacaggcacc
aggatcaagctcatcgacttcggtctggccaggaggttggagaatgcggggtctctgaag
gtcctctttggcaccccggagttcgtcgcacccgaggtgatcaactacgagcccattggc
tatgccacggacatgtggagcatcggggtcatctgctatatcctggtcagtggactgtcc
cccttcatgggtgacaatgacaacgaaaccttagccaacgttacctcagccacctgggac
ttcgacgacgaggcctttgacgagatctccgatgacgccaaggattttatcagcaacttg
ctgaagaaggatatgaaaaaccgcttgaactgcacccagtgccttcagcatccatggcta
atgaaagacaccaagaacatggaggccaagaaactctccaaggaccggatgaagaagtac
atggcaagaaggaaatggcagaaaacgggcaatgctgtgagagccatcggaagactgtcc
tctatggcaatgatctcagggctcagtggcaggaaatcctcaacagggtcaccaaccagc
ccgctcaatgcagaaaaactagaatctgaagaagatgtctcccaagctttcctggaggct
gttgctgaggagaagccccatgtaaaaccctacttttccaagaccattcgtgatttagaa
gttgtggagggaagtgctgctagatttgactgcaagattgaaggatacccggaccctgaa
gtcgtctggttcaaagatgaccaatcaatccgggagtcccgccacttccagatagactac
gacgaggatgggaactgctctttaatcattagtgatgtttgcggggatgatgatgccaag
tacacctgcaaggctgtcaacagtctcggagaagccacctgcacagcagagctcatcgtg
gaaaccatggaggaaggagaaggggaagggggagaggaggaggaggaagagtga

DBGET integrated database retrieval system