KEGG   Capra hircus (goat): 102181595
Entry
102181595         CDS       T02910                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102181595
   04668 TNF signaling pathway
    102181595
   04151 PI3K-Akt signaling pathway
    102181595
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102181595
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102181595
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102181595
   04621 NOD-like receptor signaling pathway
    102181595
   04622 RIG-I-like receptor signaling pathway
    102181595
   04623 Cytosolic DNA-sensing pathway
    102181595
   04650 Natural killer cell mediated cytotoxicity
    102181595
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102181595
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102181595
   05152 Tuberculosis
    102181595
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102181595
   05161 Hepatitis B
    102181595
   05160 Hepatitis C
    102181595
   05171 Coronavirus disease - COVID-19
    102181595
   05164 Influenza A
    102181595
   05162 Measles
    102181595
   05168 Herpes simplex virus 1 infection
    102181595
   05163 Human cytomegalovirus infection
    102181595
   05167 Kaposi sarcoma-associated herpesvirus infection
    102181595
   05169 Epstein-Barr virus infection
    102181595
   05165 Human papillomavirus infection
    102181595
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102181595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102181595
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102181595
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102181595
NCBI-ProteinID: XP_013821339
UniProt: A0A452EFB5
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALSRSFNLLRFQQRRSSVVCQNLLWQLPSTPQHCLEFRMDFQ
VPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDAIIEHLLVELHGQMNRLE
PIRKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLESKEYNRCAWTVVRVQILRNFSFLRRL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tccaggagcttcaacttgcttcgattccaacaaaggcggagctctgtggtgtgccagaac
ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag
gtccctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg
tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg
tctgacgccatcattgagcacctccttgtggaactccatgggcagatgaatcgtctggag
ccaatccggaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt
cacctgaggaaatattacttcaacctcgtgcagtacctcgagtccaaggagtacaacagg
tgtgcctggacagtcgttcgagtgcaaatcctcaggaacttttctttcctgaggagacta
acaggttacctccgggactga

KEGG   Capra hircus (goat): 102181867
Entry
102181867         CDS       T02910                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102181867
   04668 TNF signaling pathway
    102181867
   04151 PI3K-Akt signaling pathway
    102181867
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102181867
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102181867
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102181867
   04621 NOD-like receptor signaling pathway
    102181867
   04622 RIG-I-like receptor signaling pathway
    102181867
   04623 Cytosolic DNA-sensing pathway
    102181867
   04650 Natural killer cell mediated cytotoxicity
    102181867
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102181867
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102181867
   05152 Tuberculosis
    102181867
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102181867
   05161 Hepatitis B
    102181867
   05160 Hepatitis C
    102181867
   05171 Coronavirus disease - COVID-19
    102181867
   05164 Influenza A
    102181867
   05162 Measles
    102181867
   05168 Herpes simplex virus 1 infection
    102181867
   05163 Human cytomegalovirus infection
    102181867
   05167 Kaposi sarcoma-associated herpesvirus infection
    102181867
   05169 Epstein-Barr virus infection
    102181867
   05165 Human papillomavirus infection
    102181867
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102181867
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102181867
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102181867
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102181867
NCBI-ProteinID: XP_017907395
UniProt: A0A452E3N9
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQGRSLEVCQNLLWQLPSTPQHCLEFRMDFQ
MPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDTIIEHLLEELYGQMNRLE
PIQKEIMQKQNSTMGDTTDLHLRKYYFNLGQYLRSKEYNRCAWTVVQVQLLRNFSFLKSL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaagggcggagccttgaggtgtgccagaac
ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg
tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg
tctgacaccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag
ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt
cacctgaggaaatattacttcaacctcgggcagtacctcaggtccaaggagtacaacagg
tgtgcctggacagtcgtgcaagtgcaattgctcaggaacttttctttcctgaagagccta
acaggttacctccgggactga

KEGG   Capra hircus (goat): 102189208
Entry
102189208         CDS       T02910                                 

Gene name
IFNB
Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102189208 (IFNB)
   04668 TNF signaling pathway
    102189208 (IFNB)
   04151 PI3K-Akt signaling pathway
    102189208 (IFNB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102189208 (IFNB)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102189208 (IFNB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102189208 (IFNB)
   04621 NOD-like receptor signaling pathway
    102189208 (IFNB)
   04622 RIG-I-like receptor signaling pathway
    102189208 (IFNB)
   04623 Cytosolic DNA-sensing pathway
    102189208 (IFNB)
   04650 Natural killer cell mediated cytotoxicity
    102189208 (IFNB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102189208 (IFNB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102189208 (IFNB)
   05152 Tuberculosis
    102189208 (IFNB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102189208 (IFNB)
   05161 Hepatitis B
    102189208 (IFNB)
   05160 Hepatitis C
    102189208 (IFNB)
   05171 Coronavirus disease - COVID-19
    102189208 (IFNB)
   05164 Influenza A
    102189208 (IFNB)
   05162 Measles
    102189208 (IFNB)
   05168 Herpes simplex virus 1 infection
    102189208 (IFNB)
   05163 Human cytomegalovirus infection
    102189208 (IFNB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102189208 (IFNB)
   05169 Epstein-Barr virus infection
    102189208 (IFNB)
   05165 Human papillomavirus infection
    102189208 (IFNB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102189208 (IFNB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102189208 (IFNB)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102189208 (IFNB)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102189208
NCBI-ProteinID: XP_017908299
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQERSLEVCQNLLWQLPATPQHCLEARMDFQ
VPKEMMQEQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDTIIEHLLEELYGQMNRLE
PIQKEXMQKQNSTMGDTTILHLQKYYFNLRQYLKSKEYNRCAWTVVQMQLLRNFSFLKSL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaagagcggagccttgaggtgtgccagaac
ctcctgtggcagttacctgcaactcctcaacattgcctggaggccaggatggacttccag
gtccccaaggagatgatgcaagaacagcagttccggaaggaagatgccgtattggtcatg
tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg
tctgacaccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggaa
ccaatccagaaggaantaatgcagaagcaaaattccactatgggagacacgaccattctt
cacctgcagaaatattacttcaacctcaggcagtacctcaagtccaaggaatacaacagg
tgtgcctggacagtcgtgcaaatgcaattgctcaggaacttttctttcctgaagagccta
acaggttacctccgtgactga

KEGG   Capra hircus (goat): 108633243
Entry
108633243         CDS       T02910                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108633243
   04668 TNF signaling pathway
    108633243
   04151 PI3K-Akt signaling pathway
    108633243
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108633243
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108633243
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108633243
   04621 NOD-like receptor signaling pathway
    108633243
   04622 RIG-I-like receptor signaling pathway
    108633243
   04623 Cytosolic DNA-sensing pathway
    108633243
   04650 Natural killer cell mediated cytotoxicity
    108633243
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108633243
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108633243
   05152 Tuberculosis
    108633243
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108633243
   05161 Hepatitis B
    108633243
   05160 Hepatitis C
    108633243
   05171 Coronavirus disease - COVID-19
    108633243
   05164 Influenza A
    108633243
   05162 Measles
    108633243
   05168 Herpes simplex virus 1 infection
    108633243
   05163 Human cytomegalovirus infection
    108633243
   05167 Kaposi sarcoma-associated herpesvirus infection
    108633243
   05169 Epstein-Barr virus infection
    108633243
   05165 Human papillomavirus infection
    108633243
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108633243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108633243
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108633243
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108633243
NCBI-ProteinID: XP_005683680
UniProt: A0A452DNT4
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALSRSFNLLRFQQRRSSVVCQNLLWQLPSTPQHCLEFRMDFQ
VPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDAIIEHLLVELHGQMNRLE
PIQKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLESKEYNRCAWTVVRVQILRNFSFLRRL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tccaggagcttcaacttgcttcgattccaacaaaggcggagctctgtggtgtgtcagaac
ctcctgtggcagttaccttcaactcctcaacattgcctcgagttcaggatggacttccag
gtccccgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg
tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg
tctgacgccatcattgagcacctccttgtggaactccatgggcagatgaatcgtctggag
ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt
cacctgaggaaatattacttcaacctcgtgcagtacctcgagtccaaggagtacaacagg
tgtgcctggacagtcgttcgagtgcaaatcctcaggaacttttctttcctgaggagacta
acaggttacctccgtgactga

KEGG   Capra hircus (goat): 108636544
Entry
108636544         CDS       T02910                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636544
   04668 TNF signaling pathway
    108636544
   04151 PI3K-Akt signaling pathway
    108636544
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636544
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108636544
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108636544
   04621 NOD-like receptor signaling pathway
    108636544
   04622 RIG-I-like receptor signaling pathway
    108636544
   04623 Cytosolic DNA-sensing pathway
    108636544
   04650 Natural killer cell mediated cytotoxicity
    108636544
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108636544
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108636544
   05152 Tuberculosis
    108636544
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108636544
   05161 Hepatitis B
    108636544
   05160 Hepatitis C
    108636544
   05171 Coronavirus disease - COVID-19
    108636544
   05164 Influenza A
    108636544
   05162 Measles
    108636544
   05168 Herpes simplex virus 1 infection
    108636544
   05163 Human cytomegalovirus infection
    108636544
   05167 Kaposi sarcoma-associated herpesvirus infection
    108636544
   05169 Epstein-Barr virus infection
    108636544
   05165 Human papillomavirus infection
    108636544
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108636544
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636544
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636544
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636544
NCBI-ProteinID: XP_017907393
UniProt: A0A452DW99
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALCRSYSLLRFQQERSLEVCQNLLWQLPSTPQHCLEFRMDFQ
MPEEMKQAQQFRKEDAILVMYEMLQQIFNILTRDFSSTGWSDAIIEHLLEELYGQMNRLE
PIQKEIMQKQTSTMGDTTDLHLRKYYFNLGQYLKSKEHNRCAWTVVQVQLLRNFSFLKSL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tgcaggagctacagcttgcttcgattccaacaagagcggagccttgaggtgtgccagaac
ctcctgtggcagttaccttcaactcctcaacattgcctcgagttcaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccatattggtcatg
tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg
tctgacgccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag
ccaatccagaaggaaataatgcagaagcaaacctccactatgggagacacgaccgatctt
cacctgaggaaatattacttcaacctcgggcagtaccttaagtccaaggagcacaacagg
tgtgcctggacagtcgtgcaagtgcaattgcttaggaacttttctttcctgaagagccta
acaggttacctccgtgactga

KEGG   Capra hircus (goat): 108636629
Entry
108636629         CDS       T02910                                 

Gene name
IFNB
Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636629 (IFNB)
   04668 TNF signaling pathway
    108636629 (IFNB)
   04151 PI3K-Akt signaling pathway
    108636629 (IFNB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636629 (IFNB)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108636629 (IFNB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108636629 (IFNB)
   04621 NOD-like receptor signaling pathway
    108636629 (IFNB)
   04622 RIG-I-like receptor signaling pathway
    108636629 (IFNB)
   04623 Cytosolic DNA-sensing pathway
    108636629 (IFNB)
   04650 Natural killer cell mediated cytotoxicity
    108636629 (IFNB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108636629 (IFNB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108636629 (IFNB)
   05152 Tuberculosis
    108636629 (IFNB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108636629 (IFNB)
   05161 Hepatitis B
    108636629 (IFNB)
   05160 Hepatitis C
    108636629 (IFNB)
   05171 Coronavirus disease - COVID-19
    108636629 (IFNB)
   05164 Influenza A
    108636629 (IFNB)
   05162 Measles
    108636629 (IFNB)
   05168 Herpes simplex virus 1 infection
    108636629 (IFNB)
   05163 Human cytomegalovirus infection
    108636629 (IFNB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108636629 (IFNB)
   05169 Epstein-Barr virus infection
    108636629 (IFNB)
   05165 Human papillomavirus infection
    108636629 (IFNB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108636629 (IFNB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636629 (IFNB)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636629 (IFNB)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636629
NCBI-ProteinID: XP_017908306
UniProt: A0A452E2N8
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALCRSYSLLRFQQRRSTVVCQKLLQQLPATPQHCLEARMDFQ
VPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDAIIEHLLEELYGQMNRLE
PIQKEIMQKQNSTMGDTTDLHLQKYYFNLGQYLKSKEHNRCAWAVVQMQLLRIFSFLKSL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tgcaggagctacagcttgcttcgattccaacaaaggcggagcactgtggtgtgtcagaaa
cttctgcagcagttacctgcaactcctcaacattgcctggaggccaggatggacttccag
gttcccgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg
tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg
tctgacgccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag
ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt
cacctgcagaaatactacttcaacctcgggcagtacctcaagtccaaggagcacaacagg
tgtgcctgggcagtcgtgcaaatgcaattgctcaggatcttttctttcctgaagagccta
acaggttacctccgggactga

KEGG   Capra hircus (goat): 108636632
Entry
108636632         CDS       T02910                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636632
   04668 TNF signaling pathway
    108636632
   04151 PI3K-Akt signaling pathway
    108636632
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636632
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108636632
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108636632
   04621 NOD-like receptor signaling pathway
    108636632
   04622 RIG-I-like receptor signaling pathway
    108636632
   04623 Cytosolic DNA-sensing pathway
    108636632
   04650 Natural killer cell mediated cytotoxicity
    108636632
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108636632
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108636632
   05152 Tuberculosis
    108636632
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108636632
   05161 Hepatitis B
    108636632
   05160 Hepatitis C
    108636632
   05171 Coronavirus disease - COVID-19
    108636632
   05164 Influenza A
    108636632
   05162 Measles
    108636632
   05168 Herpes simplex virus 1 infection
    108636632
   05163 Human cytomegalovirus infection
    108636632
   05167 Kaposi sarcoma-associated herpesvirus infection
    108636632
   05169 Epstein-Barr virus infection
    108636632
   05165 Human papillomavirus infection
    108636632
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108636632
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636632
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636632
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636632
NCBI-ProteinID: XP_017908308
UniProt: A0A452EBR7
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQGRSLEVCQNLLWQLPSTPQHCLEFRMDFQ
MPEEMKQAQQFRKEDAVLVMYEMLQQIFYILTRDFSSTGWSDAIIEHLLEELYGQMNRLE
PIRKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLESKEYNRCAWTVVQVQLLRNFSFLKSL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaggacggagccttgaggtgtgccagaac
ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg
tatgagatgctccagcagatcttctatattctcaccagagacttctccagcactggctgg
tctgacgccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag
ccaatccggaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt
cacctgaggaaatattacttcaacctcgtgcagtacctcgagtccaaggagtacaacagg
tgtgcctggacagtcgtgcaagtgcaattgctcaggaacttttctttcctgaagagccta
acaggttacctccgggactga

KEGG   Capra hircus (goat): 108636634
Entry
108636634         CDS       T02910                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04668  TNF signaling pathway
chx05135  Yersinia infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636634
   04668 TNF signaling pathway
    108636634
   04151 PI3K-Akt signaling pathway
    108636634
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636634
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108636634
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108636634
   04621 NOD-like receptor signaling pathway
    108636634
   04622 RIG-I-like receptor signaling pathway
    108636634
   04623 Cytosolic DNA-sensing pathway
    108636634
   04650 Natural killer cell mediated cytotoxicity
    108636634
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108636634
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108636634
   05152 Tuberculosis
    108636634
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108636634
   05161 Hepatitis B
    108636634
   05160 Hepatitis C
    108636634
   05171 Coronavirus disease - COVID-19
    108636634
   05164 Influenza A
    108636634
   05162 Measles
    108636634
   05168 Herpes simplex virus 1 infection
    108636634
   05163 Human cytomegalovirus infection
    108636634
   05167 Kaposi sarcoma-associated herpesvirus infection
    108636634
   05169 Epstein-Barr virus infection
    108636634
   05165 Human papillomavirus infection
    108636634
  09174 Infectious disease: parasitic
   05142 Chagas disease
    108636634
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636634
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636634
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636634
NCBI-ProteinID: XP_017908309
UniProt: A0A452DNC2
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQGQSLAVCQNLLWQLPSTPQHCLEFRMDFQ
MPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDTIIEHLLEELYGQMNRLE
PIRKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLKSKEHNRCAWTVVRVQILRNFSFLRRL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaagggcagagccttgcggtgtgccagaac
ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg
tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg
tctgacaccatcattgagcacctccttgaggagctctatgggcagatgaatcgtctggag
ccaatccggaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt
cacctgaggaaatattacttcaacctcgtgcagtacctcaagtccaaggagcacaacagg
tgtgcctggacagtcgttcgagtgcaaatcctcaggaacttttctttcctgaggagacta
acaggttacctccgggactga

DBGET integrated database retrieval system