Capra hircus (goat): 102181595 Help Entry 102181595         CDS       T02910                                  Definition (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102181595    04668 TNF signaling pathway     102181595    04151 PI3K-Akt signaling pathway     102181595   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102181595  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102181595  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102181595    04621 NOD-like receptor signaling pathway     102181595    04622 RIG-I-like receptor signaling pathway     102181595    04623 Cytosolic DNA-sensing pathway     102181595    04650 Natural killer cell mediated cytotoxicity     102181595   09158 Development and regeneration    04380 Osteoclast differentiation     102181595  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102181595    05152 Tuberculosis     102181595   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102181595    05161 Hepatitis B     102181595    05160 Hepatitis C     102181595    05171 Coronavirus disease - COVID-19     102181595    05164 Influenza A     102181595    05162 Measles     102181595    05168 Herpes simplex virus 1 infection     102181595    05163 Human cytomegalovirus infection     102181595    05167 Kaposi sarcoma-associated herpesvirus infection     102181595    05169 Epstein-Barr virus infection     102181595    05165 Human papillomavirus infection     102181595   09174 Infectious disease: parasitic    05142 Chagas disease     102181595  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102181595 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102181595 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102181595 NCBI-ProteinID:  XP_013821339 UniProt:  A0A452EFB5 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSFNLLRFQQRRSSVVCQNLLWQLPSTPQHCLEFRMDFQ VPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDAIIEHLLVELHGQMNRLE PIRKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLESKEYNRCAWTVVRVQILRNFSFLRRL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagcttcaacttgcttcgattccaacaaaggcggagctctgtggtgtgccagaac ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag gtccctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgacgccatcattgagcacctccttgtggaactccatgggcagatgaatcgtctggag ccaatccggaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt cacctgaggaaatattacttcaacctcgtgcagtacctcgagtccaaggagtacaacagg tgtgcctggacagtcgttcgagtgcaaatcctcaggaacttttctttcctgaggagacta acaggttacctccgggactga

Capra hircus (goat): 102181867 Help Entry 102181867         CDS       T02910                                  Definition (RefSeq) interferon beta-2   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102181867    04668 TNF signaling pathway     102181867    04151 PI3K-Akt signaling pathway     102181867   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102181867  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102181867  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102181867    04621 NOD-like receptor signaling pathway     102181867    04622 RIG-I-like receptor signaling pathway     102181867    04623 Cytosolic DNA-sensing pathway     102181867    04650 Natural killer cell mediated cytotoxicity     102181867   09158 Development and regeneration    04380 Osteoclast differentiation     102181867  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102181867    05152 Tuberculosis     102181867   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102181867    05161 Hepatitis B     102181867    05160 Hepatitis C     102181867    05171 Coronavirus disease - COVID-19     102181867    05164 Influenza A     102181867    05162 Measles     102181867    05168 Herpes simplex virus 1 infection     102181867    05163 Human cytomegalovirus infection     102181867    05167 Kaposi sarcoma-associated herpesvirus infection     102181867    05169 Epstein-Barr virus infection     102181867    05165 Human papillomavirus infection     102181867   09174 Infectious disease: parasitic    05142 Chagas disease     102181867  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102181867 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102181867 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102181867 NCBI-ProteinID:  XP_017907395 UniProt:  A0A452E3N9 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQGRSLEVCQNLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDTIIEHLLEELYGQMNRLE PIQKEIMQKQNSTMGDTTDLHLRKYYFNLGQYLRSKEYNRCAWTVVQVQLLRNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagctacagcttgcttcgattccaacaagggcggagccttgaggtgtgccagaac ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgacaccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt cacctgaggaaatattacttcaacctcgggcagtacctcaggtccaaggagtacaacagg tgtgcctggacagtcgtgcaagtgcaattgctcaggaacttttctttcctgaagagccta acaggttacctccgggactga

Capra hircus (goat): 102189208 Help Entry 102189208         CDS       T02910                                  Gene name IFNB Definition (RefSeq) interferon beta-2   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102189208 (IFNB)    04668 TNF signaling pathway     102189208 (IFNB)    04151 PI3K-Akt signaling pathway     102189208 (IFNB)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102189208 (IFNB)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102189208 (IFNB)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102189208 (IFNB)    04621 NOD-like receptor signaling pathway     102189208 (IFNB)    04622 RIG-I-like receptor signaling pathway     102189208 (IFNB)    04623 Cytosolic DNA-sensing pathway     102189208 (IFNB)    04650 Natural killer cell mediated cytotoxicity     102189208 (IFNB)   09158 Development and regeneration    04380 Osteoclast differentiation     102189208 (IFNB)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102189208 (IFNB)    05152 Tuberculosis     102189208 (IFNB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102189208 (IFNB)    05161 Hepatitis B     102189208 (IFNB)    05160 Hepatitis C     102189208 (IFNB)    05171 Coronavirus disease - COVID-19     102189208 (IFNB)    05164 Influenza A     102189208 (IFNB)    05162 Measles     102189208 (IFNB)    05168 Herpes simplex virus 1 infection     102189208 (IFNB)    05163 Human cytomegalovirus infection     102189208 (IFNB)    05167 Kaposi sarcoma-associated herpesvirus infection     102189208 (IFNB)    05169 Epstein-Barr virus infection     102189208 (IFNB)    05165 Human papillomavirus infection     102189208 (IFNB)   09174 Infectious disease: parasitic    05142 Chagas disease     102189208 (IFNB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102189208 (IFNB) Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102189208 (IFNB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102189208 NCBI-ProteinID:  XP_017908299 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQERSLEVCQNLLWQLPATPQHCLEARMDFQ VPKEMMQEQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDTIIEHLLEELYGQMNRLE PIQKEXMQKQNSTMGDTTILHLQKYYFNLRQYLKSKEYNRCAWTVVQMQLLRNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagctacagcttgcttcgattccaacaagagcggagccttgaggtgtgccagaac ctcctgtggcagttacctgcaactcctcaacattgcctggaggccaggatggacttccag gtccccaaggagatgatgcaagaacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgacaccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggaa ccaatccagaaggaantaatgcagaagcaaaattccactatgggagacacgaccattctt cacctgcagaaatattacttcaacctcaggcagtacctcaagtccaaggaatacaacagg tgtgcctggacagtcgtgcaaatgcaattgctcaggaacttttctttcctgaagagccta acaggttacctccgtgactga

Capra hircus (goat): 108633243 Help Entry 108633243         CDS       T02910                                  Definition (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108633243    04668 TNF signaling pathway     108633243    04151 PI3K-Akt signaling pathway     108633243   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108633243  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108633243  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108633243    04621 NOD-like receptor signaling pathway     108633243    04622 RIG-I-like receptor signaling pathway     108633243    04623 Cytosolic DNA-sensing pathway     108633243    04650 Natural killer cell mediated cytotoxicity     108633243   09158 Development and regeneration    04380 Osteoclast differentiation     108633243  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     108633243    05152 Tuberculosis     108633243   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108633243    05161 Hepatitis B     108633243    05160 Hepatitis C     108633243    05171 Coronavirus disease - COVID-19     108633243    05164 Influenza A     108633243    05162 Measles     108633243    05168 Herpes simplex virus 1 infection     108633243    05163 Human cytomegalovirus infection     108633243    05167 Kaposi sarcoma-associated herpesvirus infection     108633243    05169 Epstein-Barr virus infection     108633243    05165 Human papillomavirus infection     108633243   09174 Infectious disease: parasitic    05142 Chagas disease     108633243  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108633243 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108633243 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108633243 NCBI-ProteinID:  XP_005683680 UniProt:  A0A452DNT4 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSFNLLRFQQRRSSVVCQNLLWQLPSTPQHCLEFRMDFQ VPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDAIIEHLLVELHGQMNRLE PIQKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLESKEYNRCAWTVVRVQILRNFSFLRRL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagcttcaacttgcttcgattccaacaaaggcggagctctgtggtgtgtcagaac ctcctgtggcagttaccttcaactcctcaacattgcctcgagttcaggatggacttccag gtccccgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgacgccatcattgagcacctccttgtggaactccatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt cacctgaggaaatattacttcaacctcgtgcagtacctcgagtccaaggagtacaacagg tgtgcctggacagtcgttcgagtgcaaatcctcaggaacttttctttcctgaggagacta acaggttacctccgtgactga

Capra hircus (goat): 108636544 Help Entry 108636544         CDS       T02910                                  Definition (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108636544    04668 TNF signaling pathway     108636544    04151 PI3K-Akt signaling pathway     108636544   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108636544  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108636544  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108636544    04621 NOD-like receptor signaling pathway     108636544    04622 RIG-I-like receptor signaling pathway     108636544    04623 Cytosolic DNA-sensing pathway     108636544    04650 Natural killer cell mediated cytotoxicity     108636544   09158 Development and regeneration    04380 Osteoclast differentiation     108636544  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     108636544    05152 Tuberculosis     108636544   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108636544    05161 Hepatitis B     108636544    05160 Hepatitis C     108636544    05171 Coronavirus disease - COVID-19     108636544    05164 Influenza A     108636544    05162 Measles     108636544    05168 Herpes simplex virus 1 infection     108636544    05163 Human cytomegalovirus infection     108636544    05167 Kaposi sarcoma-associated herpesvirus infection     108636544    05169 Epstein-Barr virus infection     108636544    05165 Human papillomavirus infection     108636544   09174 Infectious disease: parasitic    05142 Chagas disease     108636544  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108636544 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108636544 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108636544 NCBI-ProteinID:  XP_017907393 UniProt:  A0A452DW99 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALCRSYSLLRFQQERSLEVCQNLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFRKEDAILVMYEMLQQIFNILTRDFSSTGWSDAIIEHLLEELYGQMNRLE PIQKEIMQKQTSTMGDTTDLHLRKYYFNLGQYLKSKEHNRCAWTVVQVQLLRNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tgcaggagctacagcttgcttcgattccaacaagagcggagccttgaggtgtgccagaac ctcctgtggcagttaccttcaactcctcaacattgcctcgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccatattggtcatg tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg tctgacgccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaacctccactatgggagacacgaccgatctt cacctgaggaaatattacttcaacctcgggcagtaccttaagtccaaggagcacaacagg tgtgcctggacagtcgtgcaagtgcaattgcttaggaacttttctttcctgaagagccta acaggttacctccgtgactga

Capra hircus (goat): 108636629 Help Entry 108636629         CDS       T02910                                  Gene name IFNB Definition (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108636629 (IFNB)    04668 TNF signaling pathway     108636629 (IFNB)    04151 PI3K-Akt signaling pathway     108636629 (IFNB)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108636629 (IFNB)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108636629 (IFNB)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108636629 (IFNB)    04621 NOD-like receptor signaling pathway     108636629 (IFNB)    04622 RIG-I-like receptor signaling pathway     108636629 (IFNB)    04623 Cytosolic DNA-sensing pathway     108636629 (IFNB)    04650 Natural killer cell mediated cytotoxicity     108636629 (IFNB)   09158 Development and regeneration    04380 Osteoclast differentiation     108636629 (IFNB)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     108636629 (IFNB)    05152 Tuberculosis     108636629 (IFNB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108636629 (IFNB)    05161 Hepatitis B     108636629 (IFNB)    05160 Hepatitis C     108636629 (IFNB)    05171 Coronavirus disease - COVID-19     108636629 (IFNB)    05164 Influenza A     108636629 (IFNB)    05162 Measles     108636629 (IFNB)    05168 Herpes simplex virus 1 infection     108636629 (IFNB)    05163 Human cytomegalovirus infection     108636629 (IFNB)    05167 Kaposi sarcoma-associated herpesvirus infection     108636629 (IFNB)    05169 Epstein-Barr virus infection     108636629 (IFNB)    05165 Human papillomavirus infection     108636629 (IFNB)   09174 Infectious disease: parasitic    05142 Chagas disease     108636629 (IFNB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108636629 (IFNB) Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108636629 (IFNB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108636629 NCBI-ProteinID:  XP_017908306 UniProt:  A0A452E2N8 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALCRSYSLLRFQQRRSTVVCQKLLQQLPATPQHCLEARMDFQ VPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDAIIEHLLEELYGQMNRLE PIQKEIMQKQNSTMGDTTDLHLQKYYFNLGQYLKSKEHNRCAWAVVQMQLLRIFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tgcaggagctacagcttgcttcgattccaacaaaggcggagcactgtggtgtgtcagaaa cttctgcagcagttacctgcaactcctcaacattgcctggaggccaggatggacttccag gttcccgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgacgccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt cacctgcagaaatactacttcaacctcgggcagtacctcaagtccaaggagcacaacagg tgtgcctgggcagtcgtgcaaatgcaattgctcaggatcttttctttcctgaagagccta acaggttacctccgggactga

Capra hircus (goat): 108636632 Help Entry 108636632         CDS       T02910                                  Definition (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108636632    04668 TNF signaling pathway     108636632    04151 PI3K-Akt signaling pathway     108636632   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108636632  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108636632  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108636632    04621 NOD-like receptor signaling pathway     108636632    04622 RIG-I-like receptor signaling pathway     108636632    04623 Cytosolic DNA-sensing pathway     108636632    04650 Natural killer cell mediated cytotoxicity     108636632   09158 Development and regeneration    04380 Osteoclast differentiation     108636632  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     108636632    05152 Tuberculosis     108636632   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108636632    05161 Hepatitis B     108636632    05160 Hepatitis C     108636632    05171 Coronavirus disease - COVID-19     108636632    05164 Influenza A     108636632    05162 Measles     108636632    05168 Herpes simplex virus 1 infection     108636632    05163 Human cytomegalovirus infection     108636632    05167 Kaposi sarcoma-associated herpesvirus infection     108636632    05169 Epstein-Barr virus infection     108636632    05165 Human papillomavirus infection     108636632   09174 Infectious disease: parasitic    05142 Chagas disease     108636632  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108636632 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108636632 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108636632 NCBI-ProteinID:  XP_017908308 UniProt:  A0A452EBR7 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQGRSLEVCQNLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFRKEDAVLVMYEMLQQIFYILTRDFSSTGWSDAIIEHLLEELYGQMNRLE PIRKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLESKEYNRCAWTVVQVQLLRNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaggacggagccttgaggtgtgccagaac ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcagatcttctatattctcaccagagacttctccagcactggctgg tctgacgccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag ccaatccggaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt cacctgaggaaatattacttcaacctcgtgcagtacctcgagtccaaggagtacaacagg tgtgcctggacagtcgtgcaagtgcaattgctcaggaacttttctttcctgaagagccta acaggttacctccgggactga

Capra hircus (goat): 108636634 Help Entry 108636634         CDS       T02910                                  Definition (RefSeq) interferon beta-2   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108636634    04668 TNF signaling pathway     108636634    04151 PI3K-Akt signaling pathway     108636634   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108636634  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108636634  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108636634    04621 NOD-like receptor signaling pathway     108636634    04622 RIG-I-like receptor signaling pathway     108636634    04623 Cytosolic DNA-sensing pathway     108636634    04650 Natural killer cell mediated cytotoxicity     108636634   09158 Development and regeneration    04380 Osteoclast differentiation     108636634  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     108636634    05152 Tuberculosis     108636634   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108636634    05161 Hepatitis B     108636634    05160 Hepatitis C     108636634    05171 Coronavirus disease - COVID-19     108636634    05164 Influenza A     108636634    05162 Measles     108636634    05168 Herpes simplex virus 1 infection     108636634    05163 Human cytomegalovirus infection     108636634    05167 Kaposi sarcoma-associated herpesvirus infection     108636634    05169 Epstein-Barr virus infection     108636634    05165 Human papillomavirus infection     108636634   09174 Infectious disease: parasitic    05142 Chagas disease     108636634  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108636634 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108636634 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108636634 NCBI-ProteinID:  XP_017908309 UniProt:  A0A452DNC2 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQGQSLAVCQNLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFRKEDAVLVMYEMLQHIFNILTRDFSSTGWSDTIIEHLLEELYGQMNRLE PIRKEIMQKQNSTMGDTTDLHLRKYYFNLVQYLKSKEHNRCAWTVVRVQILRNFSFLRRL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagctacagcttgcttcgattccaacaagggcagagccttgcggtgtgccagaac ctcctgtggcagttaccttcaactcctcagcattgcctcgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccgtattggtcatg tatgagatgctccagcacatcttcaatattctcaccagagacttctccagcactggctgg tctgacaccatcattgagcacctccttgaggagctctatgggcagatgaatcgtctggag ccaatccggaaggaaataatgcagaagcaaaactccactatgggagacacgaccgatctt cacctgaggaaatattacttcaacctcgtgcagtacctcaagtccaaggagcacaacagg tgtgcctggacagtcgttcgagtgcaaatcctcaggaacttttctttcctgaggagacta acaggttacctccgggactga

DBGET integrated database retrieval system