KEGG   Capra hircus (goat): 102181625
Entry
102181625         CDS       T02910                                 

Gene name
TRIM25
Definition
(RefSeq) tripartite motif containing 25
  KO
K10652  tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx05164  Influenza A
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102181625 (TRIM25)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102181625 (TRIM25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102181625 (TRIM25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:chx04121]
    102181625 (TRIM25)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102181625 (TRIM25)
Ubiquitin system [BR:chx04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    102181625 (TRIM25)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4 zf-C3HC4_4 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4_3 zf-RING_2 zf-RING_5 Prok-RING_4 C5HCH zf-RING_11 DUF4088 Exonuc_VII_L U-box
Other DBs
NCBI-GeneID: 102181625
NCBI-ProteinID: XP_005709605
UniProt: A0A452EC58
LinkDB
Position
19
AA seq 633 aa
MAELCPLAEELSCSICLEPFKDPVTTPCGHNFCGACLDETWAVQGAPYLCPQCRTGFPAR
PQLRKNTVLCAVVEQFLQAEQARPALAADGWTPPTRAAAPSAAGQVACDHCLQATAVKTC
LVCMASFCQEHLRPHLDSPAFQDHPLQPPVRDLMRRKCARHNRLRDFFCPQHSECICHVC
VVDHKTCSPAPLNEASTDLENKLRQKLTVMYGQINGASRALEDVRARQQEVQEAAHRKMD
QLRQEYLEMKALIDASEASAARKIKEEEKRVTSKFDNIYQIILKKRSEIQTLKEEVELAL
TKGDEFEFLEKAAKLQGVTTKPVFVPKVELNHELIKEVYQGASDLKNELKRALRQPQDKK
PEELTVPGDAGGPCAPHTPKPHRPVKKVVKEEKKPRKPASALLNKPVTFGSSEHLVNLKQ
PGQEGAAKAPAVPPTSASLNAKVLENFLSKSRPELLEYVVKVVLDYNTAHSKVALSENYT
VASVAETSLNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGVCYGSMERQG
PESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVLFFAAADKV
HLLYKYKVDFTEAVYPAFWLFSTGATLSICSSK
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggcggagctgtgcccgctggccgaggagctgtcgtgctccatctgcctggagcccttc
aaggacccggtcaccacgccgtgcggccacaacttctgcggcgcgtgcctggacgagacg
tgggccgtccagggcgcgccgtacctctgcccgcagtgccgcaccggcttccccgcgcgg
ccgcagctgcgcaagaacacggtgctgtgcgcggtggtggagcagttcctgcaggccgag
caggcccggcccgcgctcgccgccgacggctggacgccgcccacccgcgccgccgccccc
agcgcggccggccaggtggcctgcgaccactgcctgcaggccaccgccgtcaagacgtgc
ctggtgtgcatggcctccttctgccaggagcacctgcggccgcacctggacagccccgcc
ttccaggaccacccgctgcagccgcccgtccgcgacctgatgcgccgcaagtgcgcccgc
cacaaccgcctgcgggacttcttctgcccccagcacagcgagtgtatctgccacgtctgc
gtggtggaccacaagacctgctcgcctgcgcccctcaacgaggccagcaccgacctggag
aacaagttgaggcaaaaactgactgtcatgtacggccagatcaatggggcatcaagagcg
ctggaggacgtgagagccaggcagcaggaggtgcaggaggctgcacataggaagatggac
cagctgagacaggaatacctggagatgaaggctctcatcgatgcctccgaggccagcgcc
gcaaggaagataaaggaagaggagaagagggtcaccagcaagttcgacaacatttaccag
atcatcctcaagaagaggagtgagatccagaccctaaaggaggaggttgaactcgccctg
actaagggggacgagtttgagtttctggagaaagcggcaaagctgcagggagtcaccacg
aagccagtcttcgtccccaaggtggagctgaaccacgagctgattaaggaggtctatcag
ggcgcctccgacctcaagaatgagctgaagcgggccctcagacagccccaggacaagaag
cccgaggagctcaccgtcccaggggacgctggaggaccctgcgcaccacacacaccgaag
ccccaccggcctgtgaagaaggttgtgaaagaagagaagaagcccaggaaacctgcctct
gccttactcaacaagcctgtcacctttggatcctcggaacacttagtgaatctcaaacaa
cctggccaggagggtgcagccaaagcccctgccgtgccaccgacctcagcatctctcaac
gccaaggtgctggagaacttcctaagcaagtccaggccggagctcctggagtatgtggtt
aaagttgtcctggactacaacaccgcccacagcaaggtggccctctccgagaactacacc
gtcgcgtccgtggcggaaacgtccctgaactaccggccgcatccccagcggttcacatac
tgctcgcaggtcctggggctgcactgctacaagaaggggattcactactgggaggtggag
cttcagaagaacaacttctgtggggtgggcgtctgctacggcagcatggagcggcagggc
cccgagagccggcttggccgcaacagcgcgtcctggtgtgtggagtggttcaacaccaag
atctccgcctggcacaacaacgtggagaagaccctgccgtccaccaaggccacgcgggtg
ggggtgcttctcaactgcgatcacggcttcgtgctcttcttcgccgcggctgacaaggtc
cacctgttgtacaagtacaaggtggacttcaccgaggccgtgtaccccgccttctggctc
ttctccacgggtgccacgctctccatctgctcctccaagtag

DBGET integrated database retrieval system