KEGG   Capra hircus (goat): 102182645
Entry
102182645         CDS       T02910                                 

Gene name
FN1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
chx  Capra hircus (goat)
Pathway
chx04151  PI3K-Akt signaling pathway
chx04510  Focal adhesion
chx04512  ECM-receptor interaction
chx04810  Regulation of actin cytoskeleton
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05100  Bacterial invasion of epithelial cells
chx05135  Yersinia infection
chx05146  Amoebiasis
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102182645 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102182645 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102182645 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102182645 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102182645 (FN1)
   05205 Proteoglycans in cancer
    102182645 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102182645 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102182645 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102182645 (FN1)
   05100 Bacterial invasion of epithelial cells
    102182645 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102182645 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102182645 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102182645 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102182645 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    102182645 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:chx04990]
    102182645 (FN1)
Membrane trafficking [BR:chx04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    102182645 (FN1)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   102182645 (FN1)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   102182645 (FN1)
Domain-containing proteins not elsewhere classified [BR:chx04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   102182645 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF1410
Other DBs
NCBI-GeneID: 102182645
NCBI-ProteinID: XP_005676565
UniProt: A0A452FJK2
LinkDB
Position
2
AA seq 2478 aa
MLGGPGPGLLLLLAVLSLGTAVPSAGASKSRRQAQQIVQPQSPLTVSQSKPGCYDNGKHY
QINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDQAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQTTSAGSGSFTDIRPAIYQPQPH
PQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAITQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWAC
QPLQTYPDASGPVQVIITETPSQPNSHPIQWNAPESSHISKYILRWKPKNSPNRWKEATI
PGHLNSYTIKGLRPGVVYEGQLISVQHYGQREVTRFDFTTTSTSPAVTSNTVTGETTPLT
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYTVNVYEISEEGEQNLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPRAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETT
GVPRSDKVPPPRDLQFVEVTDVKITIMWTPPQSPVTGYRVDVIPVNLPGEHGQRLPVSRN
TFAEVTGLSPGVTYHFKVFAVNQGRESKPLTAQQATKLDAPTNLQFINETDTTVIVTWTP
PRARIVGYRLTVGLTRGGQPKQYNVGPAASQYPLRNLQPGSEYAVSLVAVKGNQQSPRVT
GVFTTLQPLGSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIV
VSGLTPGVEYVYTISVLRDGQERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPI
SDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWA
PPSSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESI
PLRGRQKTALDSPSGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHMGGRPREDRVPP
SRNSITLTNLNPGTEYVVSIVALNSKEESQPLVGQQSTVSDVPRDLEVIAATPTSLLISW
DAPAVTVRYYRITYGETGGSSPVQDFTVPGSKSTATINGLKPGVDYTITVYAVTGRGDSP
ASSKPVSINYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTAPKNGPGPSKTK
TVGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTNIDRPKGLAFTDVDVSSI
KIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEETAELQGLRPGSEYTVSVVALHND
MESQPLIGTQSTAIPAPTNLKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEI
NLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENISPPRRARVTDATET
TITISWRTKTETITGFQVDAIPANGQTPIQRTIRPDVRSYTITGLQPGTDYKIHLYTLND
NARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVV
PRPRPGVTEATITGLEPGTEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGP
EILDVPSTVQKTPFITNPGYDTGNGIQLPGTSGQQPSLGQQMIFEEHGFRRTTPPTTATP
VRHRPRPYPPSVNEEIQIGHVPRGDVDHHLYPHAVGLNPNASTGQEALSQTTISWTPFQE
SSEYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEAVKDQQRQKVREEVV
TVGNSVDQGLSQPTDDSCFDPYTVSHYAVGEEWERLSDSGFKLSCQCLGFGSGHFRCDSS
KWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQW
QKEYLGAICSCTCFGGQRGWRCDNCRRPGAEPGNEGSTAHSYNQYSQRYHQRTNTNVNCP
IECFMPLDVQADTEDSRE
NT seq 7437 nt   +upstreamnt  +downstreamnt
atgctcgggggtccggggcccgggctgctgctgctgctggccgtcctgtccctggggaca
gcggtaccctccgcgggagcctcgaagagcaggagacaggcgcagcagatcgttcagccc
cagtccccgctgactgtcagtcagagcaaacctggttgttatgacaatggaaagcactat
cagataaaccaacagtgggagcgcacctacctgggcagtgccttggtctgtacctgttat
ggagggagccggggctttaattgtgagagcaagcctgaacctgaagagacttgctttgac
aagtatactgggaacacctaccgggtgggcgacacttatgagcgcccgaaggactccatg
atctgggactgtacctgcatcggggctgggcgagggagaataagctgcaccattgcaaac
cgctgccatgaaggggggcagtcctacaagattggtgacacctggaggagaccacacgag
actggtggttacatgttagagtgtgtgtgtctgggtaacgggaaaggagaatggacctgc
aagcccatagctgagaaatgttttgatcaggctgctggtacttcctacgttgtcggggag
acctgggaaaagccttatcagggctggatgatggtggactgtacttgcctgggagaaggc
agtggacgtatcacttgcacctccagaaacagatgcaacgatcaggacactaggacatcc
tatagaattggggatacctggagcaagaaggacaaccgggggaacctgctccagtgcatc
tgcacgggcaacggccgtggcgagtggaagtgtgagaggcatacctccctgcagaccaca
tctgcaggatctggctccttcactgatatccgaccagccatctaccagccccagcctcat
cctcagccgcctccgtatggtcactgtgtcacagacagcggtgtggtttactctgtgggg
atgcagtggctgaagacacaagggaataagcaaatgctgtgcacttgcctgggcaacgga
gtcagctgccaagagacagctataacccagacttacggtggcaactccaacggagagccg
tgcgtcctcccgttcacctacaatggcaggactttctactcctgcacgaccgaagggcgg
caggatggacacctctggtgcagcacaacttccaattatgagcaagaccagaaatattct
ttctgtacagaccatactgttttggttcagactcgaggtggaaattccaatggtgccttg
tgccactttcccttcctgtacaacaaccacaactacacggactgtacttctgagggcagg
agggacaacatgaaatggtgtggaaccacacagaactatgacgctgaccagaagtttgga
ttctgccccatggctgcccacgaggaaatctgtacaaccaatgaaggggtcatgtatcgc
attggagaccagtgggacaaacagcatgatatgggccacatgatgagatgcacatgtgtt
ggaaatggtcggggagaatggacgtgtgtcgcctactctcagctccgagatcagtgcatc
gtcgatggcatcacttacaacgtgaatgacacattccacaaacgtcacgaagagggacac
atgctgaattgtacctgtttcggtcagggccggggtcggtggaagtgcgatcctgttgat
caatgtcaggattcagaaacccgcacgttttatcaaattggagactcatgggagaagtat
ttgcagggggtcagataccagtgctactgctatggccgcggcattggggagtgggcctgc
cagcccttacagacctacccagatgcaagtggtcctgtccaagtaatcatcactgagacc
ccaagtcaacccaactctcaccccatccaatggaatgcaccagaatcatctcacatttcc
aagtacattcttagatggaaacctaaaaattctccaaaccgctggaaggaagctaccatt
cctggccacttaaactcctacaccatcaaaggcctgaggccaggtgtggtatacgagggc
cagcttatcagcgtccagcactatggccaaagagaggtgacgcgctttgactttaccacc
accagcacgagcccagcggtgaccagcaacactgtgacgggagagaccacacccttgact
cctgttgtggccacctctgagtcagtgactgaaatcacagccagcagctttgtggtttcc
tgggtctcggcttcggacactgtgtctggattccgggtggagtatgagctgagtgaagag
ggagatgaaccacagtacctggatcttcccagcacagccacttccgtgaacatccctgac
ctgcttcctggccgaaaatacactgtgaatgtttatgagatatctgaggaaggagagcag
aatttgatcctgtctacctcacagacaacagcacctgatgcccctcctgaccctaccgtg
gaccaagttgatgacacttctattgttgttcgctggagcagacccagggcgcccatcaca
ggatacagaatcgtctattccccatccgtagagggtagtagcacagagctcaatcttcct
gaaactgccaactctgtcactctcagtgacttgcagcctggcgttcagtataacatcacc
atctatgctgtggaagaaaatcaagaaagtactcctgtcttcatccagcaagaaaccact
ggagtcccacgttcagataaagttccccctcccagggacctgcagtttgtggaggtgaca
gatgtgaagatcaccatcatgtggacacccccacagagtccagtaaccggttaccgcgtg
gatgtgattcccgtcaacctgcccggggagcatgggcagaggctgcccgtcagcaggaac
acctttgcagaagtcaccgggctgtcccctggggtcacttatcacttcaaagtcttcgcc
gtgaaccaggggagggagagcaagcccctaacggcacagcaggcaaccaaattggatgct
cctaccaacctccagtttatcaatgaaactgataccacggtcatagtgacctggactcca
cctcgcgcccggatagtcgggtaccgactgactgtgggcctgacccggggaggccagccc
aagcagtacaatgtggggcccgcagcctcgcagtacccactgaggaacctgcagcctggc
tctgagtatgctgtaagcctcgtagccgtgaagggcaatcagcagagccccagagtcacc
ggagtcttcaccactttgcagcctctgggctccatcccaccttacaacacagaggtgact
gagaccaccattgtgattacatggacacctgccccaaggattggctttaagctgggtgta
cgaccaagccagggaggagaagcaccacgagaagtgacttcagagtcaggaagcatcgtt
gtgtctggcctgactccaggtgtggaatacgtttacaccatctctgtcctcagggatggg
caagagagagatgcaccaattgtgaagaaagtggtgacaccactgtccccaccaacgaac
ttgcacctggaggcaaaccctgacactggagtgcttaccgtttcctgggagaggagtacc
actcctgacattactggctacagaatcaccaccacccccacaaacggccagcagggatac
tctcttgaggaagtggtccatgctgatcagagttcctgcacctttgaaaacctgagtccg
ggcctggagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgtccctatc
tctgataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataact
gattcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgc
atcacagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctca
gtaggatactacacagtcacagggctggagcccggcattgactatgacatcagcgttatc
actctcattaatggcggagagagtgcccctactacactgacacaacaaacggctgtccct
cctcccactgatctgcgatttaccaatgtcggtcccgacacaatgcgtgtcacctgggct
ccaccttcatccattgaactgaccaaccttctggtacgctactcgcctgtgaaaaatgag
gaggatgttgccgagctgtcaatttctccttcagacaacgcagtggtcttaacaaatctc
ctgcctgggaccgaatatttagtcagtgtctccagtgtttacgagcagcatgagagtata
cctcttagaggaagacagaaaaccgctctcgactccccaagtggcattgacttttctgat
atcactgccaactctttcactgtccattggattgctccgcgagccaccatcactggctac
aggatccgccatcatcctgaacacatgggtggaagacctcgggaagatcgagtgcccccc
tctcggaattccatcaccctcaccaacctaaacccaggcacagaatatgtggtcagcatt
gtcgctcttaatagcaaagaggaaagtcagcccttggttggccagcaatcaacagtttct
gatgttccaagggacctggaagtcattgctgcaacccccactagcctgctgatcagctgg
gatgctcctgccgtcacagtgagatactacaggatcacctatggagaaacaggagggagt
agccctgtccaggacttcaccgtgcctgggagcaagtctacagctaccatcaatggtctt
aaacctggagtggactacaccatcactgtctatgctgtcaccggccgtggggacagcccg
gcaagcagcaagcccgtttccatcaattaccgaacagaaattgacaaaccatcccagatg
caagtgactgatgtccaagacaacagcatcagtgtcaggtggctgccttcaagttcccct
gttactggttacagagtgaccactgctcctaaaaatggcccaggaccatcgaaaacgaaa
actgtaggtccagatcaaacagaaatgacaattgaaggcttgcagcccacagtggagtat
gtggtcagtgtctatgctcagaatcaaaatggagagagtcagcctctggttcagacagcg
gtaaccaacattgatcgccctaaaggactggcattcactgatgtggatgtcagttccatc
aaaattgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagc
cctgaggatggaatccatgagctattccctgcacctgatggtgaagaagagactgcagag
ctgcaaggcctcaggccaggttctgagtacacagtcagtgtggttgccttgcacaatgat
atggagagccagcccctgattggaacccagtccacagccattcctgcaccaaccaacctg
aagttcactcaggtgacaccaaccagcctgaccgcccagtggacggcacccaatgttcag
ctcactgggtatcgagtgcgggtgaccccgaaggagaagaccggaccgatgaaagaaatc
aaccttgctcccgatagctcatctgtggttgtgtcaggactcatggttgccaccaaatat
gaagtgagtgtctatgctcttaaggacactttgacaagcagaccggctcagggagtcatt
acaactctggagaatatcagccctccaagaagggcccgggtgacagatgctaccgagacc
accatcaccattagctggagaactaagactgagacgatcaccggcttccaagttgatgct
atcccagcaaacggccagactccaattcagagaaccatcaggccagatgtcagaagttac
accatcacaggtttacaacctggtactgactacaagatccacttgtacaccttgaatgac
aatgcccggagctcccctgtggtcattgatgcctccactgccattgatgcaccatccaac
ctgcgtttcttggccaccacacccaactccctgctggtatcatggcagccaccccgtgcc
aggattactggttacatcatcaagtatgagaagcctgggtccccgcctagagaagtggtc
cctcggccccgccctggtgtcacagaagctactattactggtctggaaccaggaacagag
tacacaatccaagtcattgccctcaagaacaatcagaagagtgagcctttgattgggagg
aaaaagacagatgagctcccccagctggtaacccttccacaccccaatcttcacggacca
gagatcttggatgttccctccacagttcaaaagacccctttcatcaccaaccctgggtat
gacactggaaacggtattcagcttcccggcacttctggtcagcagcccagtcttgggcaa
caaatgatctttgaggagcatggttttaggcgaaccacaccgcccacaacggccaccccc
gtaaggcataggccaagaccgtatccgccgagtgtaaatgaggagatccaaattggtcat
gtccccaggggagacgtagaccatcatctctaccctcatgctgtgggactcaatccaaat
gcttctacaggacaagaagctctctctcagacaaccatctcatggaccccattccaggaa
agctctgaatatatcatttcatgtcatccagttggcattgatgaagaacccttacagttc
cgagttcctggaacctctgccagtgccaccttgacgggccttaccaggggggccacctac
aacatcatagtggaagcagtaaaagaccagcagaggcagaaggttcgcgaggaggtggtc
accgtgggcaattctgttgaccagggcctgagtcagcccacagatgactcctgcttcgac
ccctacacggtttcccattatgccgttggagaggagtgggagcgattgtctgattctggc
tttaaactctcgtgccagtgcttaggctttggcagtggtcatttcagatgcgattcatct
aaatggtgccatgacaacggagtgaactacaagattggagagaagtgggatcgtcagggg
gagaatggccagatgatgagctgcacgtgtcttggaaatggaaaaggagaattcaagtgt
gatcctcatgaggccacgtgctatgacgatgggaagacttaccacgtgggagaacagtgg
cagaaggaatatcttggtgccatttgctcctgcacatgctttggaggccagcggggctgg
cgttgtgacaactgccgcagaccaggggctgaaccgggtaacgaaggctccactgcccac
tcctacaaccagtattctcagagataccatcagagaacaaacactaatgtcaactgccca
attgagtgcttcatgcctttggatgtacaggctgacacagaagattcccgagagtaa

DBGET integrated database retrieval system