KEGG   Capra hircus (goat): 102182698
Entry
102182698         CDS       T02910                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04066  HIF-1 signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05200  Pathways in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102182698 (IFNGR1)
   04066 HIF-1 signaling pathway
    102182698 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102182698 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102182698 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102182698 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    102182698 (IFNGR1)
   04659 Th17 cell differentiation
    102182698 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102182698 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102182698 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102182698 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102182698 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102182698 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    102182698 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    102182698 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102182698 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102182698 (IFNGR1)
   05140 Leishmaniasis
    102182698 (IFNGR1)
   05142 Chagas disease
    102182698 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:chx04050]
    102182698 (IFNGR1)
   04090 CD molecules [BR:chx04090]
    102182698 (IFNGR1)
Cytokine receptors [BR:chx04050]
 Interleukin receptor families
  IFN receptor family
   102182698 (IFNGR1)
CD molecules [BR:chx04090]
 Proteins
  102182698 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind UPAR_LY6_2
Other DBs
NCBI-GeneID: 102182698
NCBI-ProteinID: XP_005684864
UniProt: A0A452EHZ9
LinkDB
Position
9
AA seq 500 aa
MVRGGGSDARPQPEVRAGVYPRWCWAAPALVWSSMALLFFLVPVLLTGSWVEMSAANPGL
SSVPPPANVTIQAYNLNTVIFWDYPVMLQNPMFTVQVMNYEDGKWMDACNTSERYCNIFS
VINDPSSSVWGRVKVRVGQEESVYAQSKEFILCKEGKVGPPKLGIRKKENQIIVDIFHPL
ITVNGKEPEPMYDDENTCYTFTYHVFVSVNRSETTDKMYTKEEDCNETQCFLNIPMSSLN
SQYCISAEGVSELWAVTTEKSDELCITFSDDNNTEDPVWIPVVAALLLFLVFAAVVVCCI
IKKLYPIKREGTKLPKSLLSVVKNASSEAKFDSKMISPITYQPIAVENEQLSPGTISSLH
TEDNPEKVEHGDLSSEMEVVTIEENISDLAPCSPLTPEREDSIHTSSNQSESCSITLNAY
HSRDGSDSGLVVLDNCSSSEFPPSNKTEVKTEGQDFTTLRNTTTSFGYDKPHVLVDLLVD
EGGKESLIGYRLTADSGELS
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggtccgcggcggaggaagtgacgcaagacctcagcccgaggttcgcgcgggtgtatac
ccgcggtggtgctgggcagcaccggcgttagtctggagcagcatggctctcctctttttc
ctcgtccctgtcttgctgaccggaagctgggttgagatgagcgccgcgaatccgggactc
tcttcggttccaccaccagccaatgttacaatacaagcctacaacttgaacactgttata
ttttgggattaccctgttatgctacagaatcctatgtttaccgtacaagtgatgaactat
gaggacgggaaatggatggatgcctgcaatacctccgaacgttattgtaatatcttttct
gtaattaatgatccatcgagttctgtctggggtagagttaaggtcagggttggacaagaa
gaatctgtctatgcacagtccaaagaatttattttatgcaaagaagggaaagttggacca
cctaaactgggtatcagaaagaaggaaaaccaaatcattgttgatatatttcacccttta
attactgtaaatggaaaagagccagaacctatgtatgatgatgaaaatacttgttataca
ttcacataccatgtatttgtgagcgtcaatagaagtgagaccacggataaaatgtacaca
aaggaagaggattgtaatgagactcagtgcttcttaaatattcctatgtcctcgctgaat
tctcagtactgtatttcagcagaaggagtctcagaattatgggctgttacaactgaaaag
tctgatgaactttgtattacattttctgatgataacaacacagaagatcctgtttggatt
cctgtcgttgctgctttactcctctttcttgtatttgctgcagtagttgtatgctgcatc
attaagaagttgtatccaattaagcgagaaggcaccaagttacccaaatccttgctgtct
gtggtgaaaaatgcctcttcagaggcaaaatttgattcaaaaatgatatcacccatcacc
taccagccaattgccgtagaaaatgaacagctgtccccagggaccatttcaagcctacac
actgaggacaatccagaaaaagtggaacacggagatctttctagtgaaatggaagtggtg
accattgaagaaaatatttctgacttggccccatgtagtcctctgaccccagagagagag
gattctatccacacaagcagcaatcagtctgaatcctgcagcatcactttgaatgcgtat
cactccagagatggctctgatagtggcctggtggtgttagacaactgctccagctcagaa
tttcccccaagtaataaaactgaagtaaagactgaaggacaggacttcacaacgctgaga
aacaccaccacctcctttggttacgataaaccgcacgtgttagtggatctgcttgtggat
gaaggtggtaaagagtccttaattggttacagacttacagcagactccggagagttgtca
tga

KEGG   Capra hircus (goat): 102191269
Entry
102191269         CDS       T02910                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04066  HIF-1 signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05200  Pathways in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102191269 (IFNGR2)
   04066 HIF-1 signaling pathway
    102191269 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102191269 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102191269 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102191269 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    102191269 (IFNGR2)
   04659 Th17 cell differentiation
    102191269 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102191269 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102191269 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102191269 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102191269 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102191269 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    102191269 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    102191269 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102191269 (IFNGR2)
   05140 Leishmaniasis
    102191269 (IFNGR2)
   05142 Chagas disease
    102191269 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:chx04050]
    102191269 (IFNGR2)
Cytokine receptors [BR:chx04050]
 Interleukin receptor families
  IFN receptor family
   102191269 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 Pur_ac_phosph_N UL73_N
Other DBs
NCBI-GeneID: 102191269
NCBI-ProteinID: XP_017901930
UniProt: A0A452F1L5
LinkDB
Position
1
AA seq 355 aa
MRPPPPTLLPPLLLLLSGFGAAAPPADSLAQLPTPGNLKVHLYNAQQALSWEPVSLDSDP
RLVVYQVQYKYSTSSNWYDVNKEDSKVDCTNLTRTECDFTANSLSEGFPRRFNISLRVRA
KLGGLVSAWATAPWFEHYRNATIGPPENIRVTPEEGSLIIRLSAPFDVPASEAYFVYYVY
YWEKAGDKQVTDPFESNFITLNDLKPLRVYCFQVQAKLILTKENISRPGHLSKISCSKTA
ADASVKLQQDILAAVTTFLVLSVVVGSCLFLVLKYRGLVKHWFHSPPSIPSQIEEYLKDP
AQPILDALDKDSSPKEDTWDSVSVVTFPENEQEGTPQSAWNQNTEPSHQPTEGVL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgcggccgccgccgccgacactgctgccgccgctgctcctgctgctcagcggcttcggc
gctgcggcgccccccgcagactccctggcccagctgcctactcctggaaacctgaaggtt
catctgtacaacgcccagcaggcgctgagctgggagccagtgtccctggacagcgacccg
aggctggtggtctaccaggtgcagtataaatacagcaccagtagtaactggtatgacgtc
aacaaagaagatagcaaggtggattgtacgaacctcaccagaacagagtgtgactttacc
gcaaacagcctctcggaggggttcccacggcgtttcaacatctctttacgtgttcgagct
aagctggggggcctcgtttctgcctgggcaacagcaccttggttcgaacactatcggaat
gctaccattgggcctccagaaaacatccgggtgaccccagaagaaggctcgcttatcatc
aggctttctgctcccttcgatgtccctgcctccgaggcctattttgtgtattatgtctac
tactgggagaaggcaggagacaagcaggtgacagaccctttcgagagtaacttcatcaca
ttgaacgatttaaaacccttaagggtatactgttttcaagtccaggcaaaactgattttg
accaaagaaaacatctctcgacctggacatttaagcaaaatatcatgctccaaaacagca
gcagatgcctctgtcaagcttcagcaagacatcctcgccgccgtgacaacctttttggtg
ctgtcagtggtggtggggtcctgtctcttcctggttctgaaatacagaggcctggttaag
cactggttccactctccgccaagcattccatcacagatagaagagtatttaaaggacccg
gctcagcccatcttagacgccctggacaaggacagctcaccaaaggaagacacctgggac
tccgtgtctgttgtgacgtttccagagaatgagcaagaagggactccccaaagtgcttgg
aaccaaaacactgagccaagccaccagcccacggaaggagttctctga

DBGET integrated database retrieval system