KEGG   Capra hircus (goat): 102182757
Entry
102182757         CDS       T02910                                 

Gene name
TLR3, TLR-3
Definition
(RefSeq) toll like receptor 3
  KO
K05401  toll-like receptor 3
Organism
chx  Capra hircus (goat)
Pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102182757 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102182757 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    102182757 (TLR3)
   05160 Hepatitis C
    102182757 (TLR3)
   05171 Coronavirus disease - COVID-19
    102182757 (TLR3)
   05164 Influenza A
    102182757 (TLR3)
   05168 Herpes simplex virus 1 infection
    102182757 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102182757 (TLR3)
   05165 Human papillomavirus infection
    102182757 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:chx04054]
    102182757 (TLR3)
   04090 CD molecules [BR:chx04090]
    102182757 (TLR3)
Pattern recognition receptors [BR:chx04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   102182757 (TLR3)
CD molecules [BR:chx04090]
 Proteins
  102182757 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD LRR_1 TIR TIR_2 LRR_9 LRRNT LRR_12
Other DBs
NCBI-GeneID: 102182757
NCBI-ProteinID: XP_017897421
LinkDB
Position
27
AA seq 933 aa
MSRPLPYHIYFFLGLLTCWILCTSSANKCTVRHEAADCSHLKLTQIPDDLPTNITVLNLT
HNQLRRLPAANFTRYSQLTILDGGFNSISKLEPELCQSLPWLEILNLQHNEISQLSDKTF
IFCMNLTELHLMSNAIQKIQNDPFKNLKNLIKLDLSHNGISSTKLGTQLQLENLQELLLS
NNKISSLTPEALDFLGNSSLKRLELSSNQIKEFSPGCFHAIGKLSGLSLNNAKLSPSLTE
KLCLELSNTSIENLSLSSNQLDTISHTTFGGLKQTNLTMLDLSCNSLRVMGNDSFAWLPH
LEYLSLEYNNIEHLSSRSFYGLSSLRHLNLRRSFARQSISLTSLPKIDDFSFQWLKRLEY
LNMEDNNFPGIKRNTFTGLVRLKILSLSNSFSSLRTLTNETFLSLASSSLLLLNLTKNKI
SKIQSGAFSWLGHLEVLDLGLNEIGQELTGQEWRGLDNIVEIYLSYNKYLELTTNSFTSV
PSLQRLMLRRVALRNVDSSPSPFHPLPNLVILDLSNNNIANINDELLKGLEKLEILDLQH
NNLARLWKHANPGGPVLFLKGLSRLHILNLESNGFDEIPVEAFKDLRELKSIDLGMNNLN
ILPLSVFDNQVSLKSLSLQKNLITSVEKTVFGLAFRNLSYLDMRFNPFDCTCESIAWFVN
WINSTHTNISELSNHYRCNTPPQYHGSPVMLFDVSPCKDSAPFELLFMINTNILLIFIFI
VLLIHFEGWRISFYWNVSVHRVLGFKEIDKAEQFEYAAYIIHAYKDRDWVWKHFSRMEEE
DHTLRFCLEERDFEAGVLELEAIVNSIRRSRKIVFVITQNLLKDPLCKRFKVHHAVQQAI
EQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERGIFPTQGANPCLLYL
LIWQADSLLLCHLGIPYTQEKKAFILHFDYLIK
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgagcaggcctttgccttatcatatctacttctttttgggactgttgacctgttggata
ttatgtacatcttcggccaacaaatgtactgttagacatgaagcagccgattgcagtcat
ctgaagttgacccaaatacctgatgacctcccaacaaacataactgtgttgaatcttacc
cataatcaactcagaagattgccagctgccaattttacaagatacagccaacttactatc
ttggatgggggatttaactccatctcaaagctggagccagaactgtgtcaaagtctccct
tggttggaaattttgaacctccaacacaatgagatatctcagctttctgataaaaccttt
atcttctgcatgaatttgactgaactccatctaatgtccaatgcaatccaaaaaattcaa
aatgatccctttaaaaacctgaagaatttaatcaaattagacctctctcacaatggcata
tcatctacgaaattaggaactcagctccaactggagaacctccaagagcttctattatca
aataacaaaatttcttcactaacaccagaagcacttgatttccttggcaattcttcttta
aaaagattagagttgtcatcaaatcaaatcaaagagttctctcctgggtgttttcatgcc
attggaaaattatctggcctctctctgaacaatgccaagctgagccccagtctcacagag
aagctctgcttggaattgtcaaatacaagcattgagaatctgtccctgagcagcaaccag
ctggacacaatcagccacacgaccttcggtggactgaaacagacaaatctcaccatgctg
gacctttcttgtaactccttacgtgtgatgggtaatgactcctttgcctggcttccgcat
ctcgagtacctctctctggagtataacaacatagagcatttgtcttctcgctctttctat
gggctttccagcttgagacacctgaacttgagacggtcttttgctagacaaagcatttca
ctgacttcgctccccaagattgacgatttttcctttcagtggctaaaacgtttggagtac
ctcaacatggaagataacaactttccaggcataaaaagaaatactttcacaggattggtg
aggctgaaaattttaagtctatccaactccttctcaagtttgcggactttaacaaatgag
acatttctatcactcgctagttcttctctgctcctactcaacctaaccaaaaataaaatc
tcaaaaattcagagtggtgctttttcttggttggggcacctggaggtccttgacctcggc
cttaatgaaattgggcaagaactcacaggccaggaatggagaggcctagacaatattgtc
gaaatctacctttcctacaacaaatacctagagctgaccaccaactctttcacctcagtt
ccaagccttcaaagactgatgcttcgaagggtggccctgagaaatgtggatagctcccct
tcaccttttcaccctcttccgaacctggtcattctggatctaagcaacaacaacatagcc
aacataaatgatgaactgttgaagggtcttgagaaactggaaattctggatttgcagcat
aacaacttagctcggctctggaagcatgccaaccctggtggccctgttctgtttctgaag
ggcctttctcgcctccacatccttaacttggagtctaatggctttgatgagatcccagtg
gaagccttcaaggacttgcgtgaattgaagagtattgatttaggaatgaataatttaaat
atccttccactatctgtctttgataatcaagtgtcactaaagtcattaagccttcagaag
aacctcataacatctgttgaaaagactgtttttgggctagcattcaggaacctgagttat
ttagatatgcgtttcaatccatttgattgtacctgtgaaagcatcgcctggtttgttaat
tggattaatagcacccacaccaacatctctgagctgtccaaccattaccgctgcaacact
ccgcctcagtaccatggttccccagtaatgctttttgatgtatcgccgtgcaaagacagt
gccccatttgaactccttttcatgattaacaccaatatccttttgatttttatctttatt
gtactgctcatccattttgaaggctggaggatatctttttattggaatgtttcagtgcat
cgagttctcggtttcaaagaaatagacaaagcagagcagtttgaatatgcagcgtatata
attcatgcctataaagatagagattgggtctggaagcacttctcccgaatggaggaagaa
gatcatactctcagattttgtctggaagaaagggactttgaggcaggtgttcttgaactt
gaagcaattgtgaacagcatcagaaggagcagaaaaattgttttcgttataacacagaat
ctattgaaagatccattatgcaaaagattcaaggttcaccatgcagttcagcaagctatt
gaacaaaatctggattccattatattgatctttcttgaggagattccggattataaactg
aaccacgcactctgtttgcgaagagggatgtttaaatctcattgcatcttgaactggccg
gttcagaaagaacgggggatcttcccaacccagggagcaaacccgtgtctcttgtacctc
ctgatctggcaggcggattctttactactgtgccacctgggaatcccatatactcaggaa
aaaaaagcattcattcttcattttgattacttaataaaatga

DBGET integrated database retrieval system