KEGG   Capra hircus (goat): 102182890
Entry
102182890         CDS       T02910                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04012  ErbB signaling pathway
chx04015  Rap1 signaling pathway
chx04062  Chemokine signaling pathway
chx04137  Mitophagy - animal
chx04144  Endocytosis
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04520  Adherens junction
chx04530  Tight junction
chx04540  Gap junction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04625  C-type lectin receptor signaling pathway
chx04727  GABAergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx05100  Bacterial invasion of epithelial cells
chx05135  Yersinia infection
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05219  Bladder cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102182890 (SRC)
   04015 Rap1 signaling pathway
    102182890 (SRC)
   04370 VEGF signaling pathway
    102182890 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102182890 (SRC)
   04137 Mitophagy - animal
    102182890 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102182890 (SRC)
   04520 Adherens junction
    102182890 (SRC)
   04530 Tight junction
    102182890 (SRC)
   04540 Gap junction
    102182890 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102182890 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102182890 (SRC)
   04613 Neutrophil extracellular trap formation
    102182890 (SRC)
   04625 C-type lectin receptor signaling pathway
    102182890 (SRC)
   04062 Chemokine signaling pathway
    102182890 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102182890 (SRC)
   04915 Estrogen signaling pathway
    102182890 (SRC)
   04917 Prolactin signaling pathway
    102182890 (SRC)
   04921 Oxytocin signaling pathway
    102182890 (SRC)
   04926 Relaxin signaling pathway
    102182890 (SRC)
   04919 Thyroid hormone signaling pathway
    102182890 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    102182890 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102182890 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    102182890 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102182890 (SRC)
   05203 Viral carcinogenesis
    102182890 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    102182890 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102182890 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102182890 (SRC)
   05152 Tuberculosis
    102182890 (SRC)
   05100 Bacterial invasion of epithelial cells
    102182890 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102182890 (SRC)
   05168 Herpes simplex virus 1 infection
    102182890 (SRC)
   05163 Human cytomegalovirus infection
    102182890 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102182890 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102182890 (SRC)
   01522 Endocrine resistance
    102182890 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102182890 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102182890 (SRC)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102182890 (SRC)
Protein kinases [BR:chx01001]
 Non-receptor tyrosine kinases
  SRC family
   102182890 (SRC)
Membrane trafficking [BR:chx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102182890 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    102182890 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102182890 (SRC)
  Macropinocytosis
   Kinases
    102182890 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 102182890
NCBI-ProteinID: XP_017913326
LinkDB
Position
13
AA seq 548 aa
MGSNKSKPKDASQRRRSLEPAENTHGGGGGGGGGGGAFPSSQTPSKPASSDGHRGPNTAF
APAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIV
NNTRKVDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNA
ENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQ
LVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGT
WNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGS
LLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLVCKVADF
GLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPG
MVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEP
QYQPGENL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagcct
gccgagaacacccacggaggcggcggcggtggaggcggtggtgggggtgccttcccctcc
tcacagacccccagcaagccagcctcctctgatggccaccgcggccccaacacagccttc
gcccctgcagccgctgagcccaagctgttcggaggcttcaactcctctgacacagtcacc
tccccgcagagggcggggcccctggctggcggagtgaccaccttcgtggccctctatgac
tatgagtcgcggacagagactgacctgtctttcaagaaaggggagcggcttcagattgtc
aacaacacgaggaaggtggatgtcagagagggagactggtggctggcccactcgctcagc
acaggacagacgggctacatccccagcaactatgtggcgccctctgactccatccaggct
gaagagtggtactttggcaagatcaccagacgggagtcagagcggttactgctcaatgca
gagaacccaagagggaccttcctagtgcgagaaagcgagaccacgaaaggcgcctactgc
ctctcggtgtccgacttcgacaatgccaagggcctcaacgtgaagcactataagatccgc
aagctggacagcggcggcttctacatcacctcccgcacccagttcaacagcctgcagcag
ctggtggcctactactccaaacatgctgatggcctctgccaccgcctcaccactgtgtgc
cccacgtctaagccgcagactcaaggcctggccaaggatgcctgggagatcccccgggag
tcgctgcggctggaggtcaagctgggccagggctgcttcggagaggtgtggatgggtacc
tggaacggcaccaccagggttgccatcaaaaccctgaagcctggtacgatgtctccggag
gccttcctgcaggaggcccaggtcatgaagaaactgaggcatgagaaactcgtgcagctg
tacgccgtggtgtccgaagagcccatctacattgtcacggagtacatgagcaaggggagt
ttgctggactttctcaagggggagacaggcaagtacctgcggctgcctcagctggtggac
atggctgcacagattgcctcaggcatggcttatgtggaacggatgaactatgtccaccga
gacctccgggctgccaacatcctggttggagagagcctcgtgtgcaaagtggctgacttc
gggctggctcgactcattgaagacaacgaatacacagcccggcaaggtgccaaattcccc
atcaagtggacggctccggaagctgccctctatggccggttcaccatcaaatcagatgtg
tggtcctttgggatcctgctgacggagctcacaacaaagggacgggtgccctaccctggg
atggtgaaccgggaggtgctggaccaggtggagcggggctaccggatgccctgcccgcct
gagtgtcccgagtcattgcatgacctgatgtgccagtgctggcggaaggacccggaggaa
cggcccaccttcgagtacctgcaggccttcctggaggactatttcacgtccaccgagccc
cagtaccagcccggagagaacctatag

DBGET integrated database retrieval system