KEGG   Capra hircus (goat): 102183188
Entry
102183188         CDS       T02910                                 

Gene name
IFIH1, MDA5
Definition
(RefSeq) interferon induced with helicase C domain 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102183188 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    102183188 (IFIH1)
   05171 Coronavirus disease - COVID-19
    102183188 (IFIH1)
   05164 Influenza A
    102183188 (IFIH1)
   05162 Measles
    102183188 (IFIH1)
   05168 Herpes simplex virus 1 infection
    102183188 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:chx04054]
    102183188 (IFIH1)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102183188 (IFIH1)
Pattern recognition receptors [BR:chx04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   102183188 (IFIH1)
SSDB
Motif
Pfam: RIG-I_C CARD_2 RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_19 AAA_22 DUF3638
Other DBs
NCBI-GeneID: 102183188
NCBI-ProteinID: XP_017919323
UniProt: A0A452FBA2
LinkDB
Position
2
AA seq 1023 aa
MSSDGSFADKNFCYLISCFRARVKRYIQVEPVLDYLTFLSPEVKEHIQRTAATTGDIQAA
DLLLNTLERGNWPLGWARMFVEALRQAGNPLAARYVNPELTDLPSPSFENAHDECLQLLN
LLQPTLVDKLLVADVLDKCVEEKLLTVEDRNRVSAAENNGNEAGVRELLKRIVQKENWFS
TFLTILRQTGNDELAQELTGTNCCEDNTESENLSQEDGLEVKEPLLLATEQPNLEVWDIE
NSSLESSLADSSIVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDDENVAQRAS
PEPELNLRPYQLEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVMV
LVNKVPLVEQLFRKEFEPFLKKWYHVTRLSGDTQLKITFPEVVKSHDVIISTAQILENSL
LNSEEGEDDGIELSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLKNNKLKTENKPVIPL
PQIVGLTASPGVGGAKKQAKAEEHILKICANLDAVTIKTVKQNINLLKEQIKEPCKKFVI
ADDTKKDPFKDKLLEIMTKIQIFCQISPMSDFGTQPYEQWLIQMEKKAAKEGNRKDRVCA
EHLRKYNEALQINDTIRMIDAYNHLETFYNDEKEKKFAVLLGDDSDESDDDGDNEDVGDG
KTPLKLHETDDFLISLFLGNKKKLKKLAQNPEHENEKLIKLRNTIMEQYSRTEGSARGII
FTKTRQSAYALSQWITENEKFSEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKI
NLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAQSGSGVVER
ETVNDFREKMMYKAIDRVQNMKPEEYAHKILELQMQSIMEKKMKTKRSIAKQFKDKPSLI
NFLCKNCSVPACSGEDIYVIEKMHHVNMTPEFKKLYFVRGNKALQTTCAEYQTNGEIICN
KCGQAWGTMMVHKGLDLPCLKIKNFVVVFQNNLPKKQYKKWVELPITFPDLNYSEYCLFS
DED
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgtcgtcggatgggagtttcgcagacaagaatttctgctatctcatctcgtgtttcagg
gccagagtgaaaaggtacatccaggtggaaccagtattggactacctgacttttctatct
ccagaagtgaaagagcatattcagaggacggccgccaccactggggacattcaggcagct
gatctgcttctgaacaccttggagagggggaactggccgctcggctgggctaggatgttc
gtagaggccctccggcaagcaggcaaccccttagccgcccgctatgtgaacccagagctc
acggacttgccttctccatcgtttgagaacgctcacgatgagtgtctccaactgctgaac
cttcttcagcccacactggtggacaagcttctggttgcagatgtcttggataaatgtgtg
gaggagaaactgttgacagttgaagacagaaatcgggtttctgctgcagaaaataatgga
aatgaagcaggggtaagagagctactgaaaaggattgtgcagaaagaaaactggttttct
acatttctaactattctgaggcagacgggaaatgatgagcttgcccaggagttaacaggc
accaattgttgtgaagacaatacagagtctgagaatttatcacaagaagatggtctcgaa
gtcaaagagccactccttttagccacggagcagccaaatctggaggtctgggacatagag
aatagttcactggaatcgtctcttgcagattcttctatagtttcagaatcagacacaagt
ttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatgggc
agtgattcaggcaccatgggaagtgattcagatgatgagaatgtggctcaaagagcatcc
cccgagccagagctgaatctcaggccttaccagctggaagtggcccagcctgccctggag
gggaagaacatcattatatgcctccctacagggagtgggaaaaccagagtggccgtttac
attgccaaggatcacttggataagaagaaaaaagcatctgaacctggaaaagttatggtt
ctcgtcaataaggtaccattagttgaacagctcttccgcaaagagttcgaaccatttttg
aagaaatggtatcatgttactagattaagtggtgatacccaattgaaaataacatttcca
gaagttgtcaagtctcatgatgttattatcagtacagctcaaatccttgaaaactccctt
ttaaactcagaagaaggtgaagatgatggtatagagttgtcagacttttctctcatcatc
attgatgaatgccatcacaccaacaaagaagcggtttataacaacatcatgaggcgttat
ttgaaacagaagttgaaaaacaataaacttaagacagaaaacaaaccagtgattccctta
cctcaaatagtgggactaacagcctcaccaggtgtcggaggagccaaaaagcaagccaaa
gcagaagaacacattttaaaaatatgtgccaatcttgatgcagttaccattaaaaccgtg
aaacaaaatattaatctacttaaagagcaaataaaggagccatgcaaaaagtttgtaatt
gcagatgacaccaaaaaagacccatttaaagataagctgctagaaataatgacaaagatt
caaattttttgccaaattagtccaatgtcagattttggaactcaaccctatgaacaatgg
ctcattcaaatggaaaaaaaagctgcaaaagaaggaaatcgcaaagatcgtgtttgtgca
gaacatctgaggaagtacaatgaggccctacaaattaatgacacaatccgtatgattgat
gcatataatcaccttgaaactttctacaatgacgagaaagagaagaagtttgcggtcctc
ctaggagatgacagtgatgagagtgatgacgatggcgataatgaagatgtaggtgatgga
aaaacacctttgaagctgcatgagacagatgactttctcatatctctatttttgggaaat
aagaaaaagttgaaaaaactagcccaaaacccagaacatgaaaatgaaaagctcatcaaa
ttgagaaacaccataatggaacaatattcaaggactgaagggtcagcacgaggaataatt
ttcacaaaaacacgacagagtgcatatgccctttcccagtggattactgaaaatgaaaaa
ttttcagaagtaggagtcaaagcccaccatcttattggcgctggacacagcagtgagttc
aagcccatgacacagaatgaacaaaaagaagtcattagtaaatttcgcacgggaaaaata
aatctgcttatcgctaccacagtggcagaagaaggtctggatattaaagaatgtaatatc
gttatccgttatggtctcgtcactaatgaaatagccatggtccaggcccgtggtcgagcc
agagctgatgagagcacctatgttctggttgcccaaagcggctcaggggttgttgaacgt
gagacagttaatgatttccgagagaaaatgatgtataaagctatagaccgtgttcaaaat
atgaaaccagaggagtatgctcataagattttggaattacagatgcaaagtataatggaa
aagaaaatgaaaaccaagagaagtattgcaaagcagttcaaggacaagccatcattaata
aattttctgtgtaaaaactgtagtgtgccagcctgctctggagaagatatctacgtaatt
gagaagatgcaccatgtcaatatgacaccagagttcaagaaactgtactttgtgagagga
aacaaagcactgcaaacaacgtgtgctgagtatcaaacaaatggcgagataatctgcaat
aaatgtggccaagcttggggaacgatgatggtgcacaaaggcttagatttgccttgtctc
aaaataaagaattttgtagtggttttccaaaataatttaccaaagaaacaatacaaaaag
tgggtagaattaccaatcacatttcctgatcttaactattcggaatattgtttgtttagt
gatgaggactga

DBGET integrated database retrieval system