KEGG   Capra hircus (goat): 102183195Help
Entry
102183195         CDS       T02910                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00020  Citrate cycle (TCA cycle)
chx00190  Oxidative phosphorylation
chx01100  Metabolic pathways
chx01200  Carbon metabolism
chx04714  Thermogenesis
chx04932  Non-alcoholic fatty liver disease (NAFLD)
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05016  Huntington disease
Module
chx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
chx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
chx_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102183195 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102183195 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102183195 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102183195 (SDHB)
   05012 Parkinson disease
    102183195 (SDHB)
   05016 Huntington disease
    102183195 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102183195 (SDHB)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102183195 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 102183195
NCBI-ProteinID: XP_017910171
LinkDB All DBs
Position
2
AA seq 303 aa AA seqDB search
MAAVVALSLRRGFPAAALGGARLQAFPASGSSLSSWLFTAVSPSGLPACRGAQTAAVAAP
RIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGI
CGSCAMNINGGNTLACTRRIDTNLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYL
KKKDESQGGKEQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYR
WMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKQ
ASA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgctctctccttgaggcgcgggttcccggccgccgccctcggcggg
gcccgcctgcaggctttcccagcatcaggctcttctctcagcagttggctgttcacagca
gtttcaccatcaggccttccggcctgccgtggggcccagacagctgcagtcgcagcaccc
cgaatcaagaagtttgccatctatcgatgggacccagacaagacaggagacaaacctcat
atgcaaacttacgagattgatttgaataactgtggtcctatggtgctggatgctttaatc
aagatcaagaatgaaatcgattccaccctgaccttccggagatcctgcagagaaggcatc
tgcggctcctgtgccatgaacatcaacggaggcaacactctggcgtgcacccgcaggatc
gacaccaacctcagcaaagtttccaaaatctaccccctgccacacatgtatgtgataaag
gaccttgttcctgatttgagcaacttctatgctcagtacaagtccatcgagccttacttg
aagaagaaggatgagtcccagggaggcaaggagcagtatctgcagtccatagaagaccgt
gagaaactggacgggctctatgagtgcattctctgcgcctgctgcagcaccagctgcccg
agctactggtggaacggagacaagtacctgggccccgcggtcctcatgcaggcctatcgc
tggatgatcgactccagagacgacttcacggaggagcgcctggccaagctgcaggacccc
ttctctctctaccgctgccacaccatcatgaactgcacgcggacctgccccaaggggctg
aatcctgggaaagctattgctgaaatcaagaagatgatggcaacctataaagagaagcag
gcttctgcttaa

DBGET integrated database retrieval system