KEGG   Capra hircus (goat): 102183788
Entry
102183788         CDS       T02910                                 

Gene name
DDX58
Definition
(RefSeq) DExD/H-box helicase 58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102183788 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102183788 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    102183788 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    102183788 (DDX58)
   05160 Hepatitis C
    102183788 (DDX58)
   05171 Coronavirus disease - COVID-19
    102183788 (DDX58)
   05164 Influenza A
    102183788 (DDX58)
   05162 Measles
    102183788 (DDX58)
   05168 Herpes simplex virus 1 infection
    102183788 (DDX58)
   05169 Epstein-Barr virus infection
    102183788 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:chx04054]
    102183788 (DDX58)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102183788 (DDX58)
Pattern recognition receptors [BR:chx04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   102183788 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD ResIII DEAD Helicase_C AAA_22 AAA_25
Other DBs
NCBI-GeneID: 102183788
NCBI-ProteinID: XP_005683623
LinkDB
Position
8
AA seq 943 aa
MTAEQRRNLHAFRGYVSKILDPTYILSYMTPWFRDDVVQHIQAEKNNKGPMEAASLFLQV
LLELQEEGWFRGFLDALHQAGYSGLCEAIESWDFQKIEKLEEYRLLLKRLQPEFKTTINP
KDILPEISGCLISQECEEIIQISSNKGLMAGAEKMIECLLRSDKENWPKTLKLALEKEES
KFSELWMVEKGAENVQMKDLEDDEMKTLDIQIVYKEEPENQNLSQNPCPSSEVPPAYSPL
KPRNFQLELALPAQKGKNTIICAPTGCGKTFVALLICEHHLKQFPQGRKGKVVFFAVQLP
LYEQQKSAFSEYFERLGYKVSGISGEIADSVSVEQIVENNDIIILTPQILVNSLKDGTIP
SLSIFTLMIFDECHNTNKNHPYNMIMFNYLDQKLGGSSDSLPQVVGLTASVGVGDAKNEA
EATEYICRLCASLDTSVLTTVRDNLEELEEVFYKPQKFFRKVESRTTDKFKCVISQLMAE
TEALAKSIFEELGTVTLENLSRIQNRNFGTQKYEQWIIAVQKACMVFQMPDKDEESRICK
ALFLYTSHLRKYNDALIISEDARMKDALNYLKNFFSNVRAAGFDAIEQDLTQRFEEKLVE
LEDISVDPSNENPKLKDLCFILQEEYHLNRETRTILFVKTRALVDALKKWIEENPKLSFL
KPCILTGRGRTNQTMGMTLPAQKCALDAFRTNRDSKILIATSVADEGIDIAQCNLVILYE
YVGNVIKMIQTRGRGRARGSKCFLLTSNADVIEKEQLNICKEKMMNDSISSLQRWNEAVF
KEKIHQIQVQEKLIRDNQGKVKPVVDKNNKKLLCGKCKTFACYTADIRVVEECHFTVVRD
AFRECFVTKSHPKPKKFGNFEKKSKIFCARKDCLHDWGIHMTYKTFEIPVIKIESFVVED
VATGAQTLYSKWKDFNFEKIPFDAAEMSAGAQDLNLQAMNGLE
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgacggccgagcagcggcggaatttgcacgccttccgcggctatgtcagcaagatcctg
gaccctacctacatcctgagctacatgaccccctggtttagggacgatgtggtgcagcat
attcaggccgagaaaaacaacaagggacccatggaggctgcctcacttttcctccaggtc
ctattggagctccaggaggaaggctggttccgtggctttttggatgcccttcaccaagca
ggttattctggactttgtgaagccattgaaagttgggatttccaaaaaattgaaaaattg
gaggagtatagattacttttaaagcgtttacaacccgaatttaaaaccacaatcaatcca
aaagatatccttcctgaaatatctggatgtttaattagtcaagaatgtgaagaaattatt
cagataagttccaacaaggggctgatggcaggtgcagagaaaatgattgaatgccttctc
agatcagacaaagagaactggcccaaaacgttgaaacttgcactggagaaagaagagagc
aagttcagcgaactgtggatggtagagaaaggtgcagaaaatgttcaaatgaaagatctt
gaggatgatgaaatgaaaactttggacatacagattgtctacaaggaagaaccagaaaac
cagaatcttagccagaatccctgtccttcttcagaagtgcctcctgcttatagcccattg
aaaccaagaaatttccaactagagctcgctttacctgctcagaagggaaagaatacaata
atatgtgctcctactggttgtggaaaaacctttgttgcccttcttatatgcgaacatcat
cttaagcaatttccgcaaggacgcaaggggaaagttgtcttttttgctgttcaactcccg
ctgtatgaacagcagaaatctgcgttctcagaatattttgaaagacttgggtacaaagtt
tcaggcatttctggagagatagctgacagtgtctctgtggaacagattgttgagaacaat
gacatcatcattttaacaccacagattcttgtgaacagccttaaagatgggactatccca
tcactctccatctttactttgatgatatttgatgaatgtcacaacaccaataaaaaccat
ccatataatatgatcatgtttaattatctagatcagaaacttggaggatcttcagactca
ctgccccaggtcgttgggctgacggcctcagttggtgttggagatgccaaaaatgaagcc
gaagccacagaatatatctgcagactgtgtgcttctctcgacacgtcagtgttaacaaca
gtcagagacaacttggaggaactggaggaggttttttataagccccagaagtttttcagg
aaagtggaatcacggactacagacaaatttaaatgcgtcatatctcagctgatggcagag
acagaggctctagcaaagagtatctttgaagaacttgggaccgtaactcttgaaaactta
tctcgcattcaaaataggaattttgggacacagaaatatgaacagtggattatcgcagtt
cagaaagcgtgcatggtgtttcagatgccagacaaagatgaagaaagcagaatttgtaaa
gccctgtttttgtacacatcacatttgcggaaatacaatgatgccctcattatcagtgag
gatgcacggatgaaagatgctctgaattacttgaaaaacttcttcagcaatgtccgggca
gcaggatttgatgcaattgagcaagatctcactcagagatttgaagaaaagctggtggaa
ctagaagatatttccgtggatcccagcaatgagaaccctaaactcaaagatctctgcttc
atcttgcaagaggaataccacttaaaccgagagaccagaaccatcctctttgtgaaaacc
cgagcactagtggatgccttaaagaagtggattgaagaaaatcctaaactcagctttcta
aaaccttgcatattgactggacgtggcagaacaaatcagacaatgggaatgaccctccca
gcacagaagtgtgcattggacgcattcagaaccaacagagacagcaagattctgattgct
acctcggttgccgatgaaggcattgacattgctcagtgcaatctggtcatcctctacgag
tatgtgggcaatgtcatcaaaatgatccaaaccagaggtagaggaagagcaagagggagc
aagtgcttccttctgactagtaatgctgatgtaatcgaaaaagaacaactgaacatctgc
aaagaaaaaatgatgaatgactccatttcaagcctgcagagatggaatgaagcagtattt
aaggaaaagattcaccagatacaggttcaagaaaaattaatcagggataatcaaggaaaa
gtaaaacctgttgttgataagaacaataaaaaactgctctgcggaaagtgcaaaaccttt
gcgtgttacacagctgatataagagtggtggaggaatgccatttcactgtggttagagat
gctttcagggagtgcttcgtgactaagtcacatcccaaaccgaagaaatttgggaatttt
gagaagaaatctaagatcttctgtgccaggaaggactgcctccatgactggggaattcac
atgacgtacaagacatttgagattccagttataaagatcgaaagttttgtggtggaagat
gttgcgactggagctcagacactatattcaaagtggaaggactttaattttgagaagatc
ccatttgatgctgcagaaatgtctgctggtgctcaggacctcaatctgcaggcaatgaat
ggccttgaatga

DBGET integrated database retrieval system