KEGG   Capra hircus (goat): 102183820
Entry
102183820         CDS       T02910                                 

Gene name
DHX58, LGP2
Definition
(RefSeq) DExH-box helicase 58
  KO
K12649  ATP-dependent RNA helicase DHX58 [EC:3.6.4.13]
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102183820 (DHX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:chx04054]
    102183820 (DHX58)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102183820 (DHX58)
Pattern recognition receptors [BR:chx04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   102183820 (DHX58)
SSDB
Motif
Pfam: RIG-I_C RIG-I_C-RD ResIII Helicase_C DEAD SWI2_SNF2 AAA_19 AAA_22
Other DBs
NCBI-GeneID: 102183820
NCBI-ProteinID: XP_017920593
LinkDB
Position
19
AA seq 680 aa
MELRPYQWEVIMPALEGKNIIIWLPTGSGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHYEEFSRMLDRRWTITTLSGDMGPRAGFGHMARRHDLLICTAELLQKALASLEEEEHV
ELNAFSLLVVDECHHTHKDTVYNIILSRYLELKLQRTRPLPQVLGLTASPGTGGASTLKG
AIDHVLQLCANLDTWSIMSPQDHSPQLQEHSHQPCKQYDLCHRHTQDPFGDMLKKLMDQI
HDHLEMPKLRRDFGTQTYEQQVVELSQDAAEAGLLEQRVYALHLRRYNDALLIHDTVRAV
DALDTLRDFYNRERATKTGVLHAERWLLALFDDHKNELARLATSGPENPKLEVLEAILQK
QFRSLDSPRGIIFTRTRQSAHSLLLWLQQQPGLQTVGIRPQVLIGAGNNSQKTQMIQMTQ
RDQQEVIQKFRTGTLNLLVATSVAEEGLDIPQCNVVVRYGLLTNEISMVQARGRARASQS
VYSFVAAQGSRELQRELTNEALEALMEQAVAAVRAMDQAEYQAKIRDLQQAALVKRAVQA
AQRESRQRKFLAEQVQLLCINCMVSVGYGSDLRKVEGTHHVNVNPNFSIYYNVSKQPVDI
SRSFKDWRPGGAISCRNCGEAWGLQIIYKSVKLPVLKVGSMLLETPQGRVRAKKWSRVPF
TVPDFDYVQYAEGLAGLSLD
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggagctgcgaccctaccagtgggaggtgatcatgcctgccctggaggggaagaatatc
atcatatggctgcccacaggctctgggaagaccagggcagctgcttatgtggccaagagg
catttagagaccgtggacggagccaaggtggttgtattggtcaacagggtgcacctggtg
acccagcattatgaggagttcagccgcatgctcgacagacgctggaccatcacaaccctg
agcggggacatggggccacgagctggctttggccacatggcccggaggcacgacctgctc
atctgcacagctgagctgctgcagaaggcactggccagcctggaagaggaggagcatgtg
gaactcaatgccttctccctgctggtggtggatgagtgtcaccacacgcacaaagacacc
gtctacaacatcatcctgagccgatacctggagctgaaactccagaggacccggccgctg
ccacaggtgctgggtctcaccgcctccccaggcactggcggtgcctccacgctcaagggg
gccattgaccacgtcctgcagctctgtgccaacctggacacatggagcatcatgtcaccc
caggaccatagcccccagctgcaggagcacagccaccagccctgcaaacagtatgacctc
tgccacaggcacacccaggacccgtttggggacatgctgaagaagctcatggaccaaatc
cacgaccacctggagatgcccaagttgagacgggacttcgggacgcagacctatgagcag
caagtggtggaactgagccaggatgcggctgaggcggggctcctggagcagcgggtgtac
gcgcttcatctgcgtcggtacaacgatgcgctgctgatccacgacacggtccgcgcggtg
gatgccctcgacacgctgcgggatttctacaacagggagcgcgccactaagaccggggtc
ctacatgctgagcgctggctgctggcgctgtttgatgatcacaagaatgagctggcccgc
ctggcaactagcggcccggagaacccgaaactggaggtgctggaagcgatcctgcagaag
cagttcaggagccttgacagcccccggggcatcatcttcacccgaacccgccagagcgct
cactccctcctgctgtggctccagcagcagccaggcctgcagacagtgggcatccggcca
caggtgttgattggggctgggaacaacagccagaagactcagatgatccagatgacacag
cgggaccagcaagaagtaatccagaagttccggactggtaccctgaacctcctggtggcc
acaagtgtggcagaggaggggctggacatcccccagtgcaatgtggtggtgcgctatggg
ctcctgaccaatgagatctccatggtccaggcaaggggccgggcccgggccagccaaagc
gtatactcgtttgtggcagcccaaggcagtcgggagctacagcgggagctaacgaatgag
gcgctggaggcgctgatggaacaggcagtggctgctgtgcgggcgatggaccaggccgag
taccaggccaagatccgggatctgcagcaggcagcgttggtcaagcgggcagtccaggca
gcccagcgagagagtcggcagcgcaagttcctggcggagcaggtgcagctcctctgcatc
aactgcatggtgtccgtgggctatgggagtgacctacggaaggtggagggtacccaccac
gtcaatgtgaaccccaacttctcgatctactacaacgtctcaaagcagcctgtggacatc
agcagaagcttcaaggactggaggcctgggggtgccattagctgccggaactgtggggag
gcctggggtctgcagataatctacaagtcagtgaagctgccggtgctcaaagttggcagt
atgctgctggagacaccacaagggcgagtccgggccaagaagtggtcccgtgtgcccttc
actgtgcctgactttgactatgtgcaatatgcggagggcctggcgggcctctctctggac
tga

DBGET integrated database retrieval system