KEGG   Capra hircus (goat): 102184154
Entry
102184154         CDS       T02910                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04062  Chemokine signaling pathway
chx04068  FoxO signaling pathway
chx04072  Phospholipase D signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04714  Thermogenesis
chx04722  Neurotrophin signaling pathway
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04926  Relaxin signaling pathway
chx04935  Growth hormone synthesis, secretion and action
chx05034  Alcoholism
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102184154 (SOS2)
   04012 ErbB signaling pathway
    102184154 (SOS2)
   04014 Ras signaling pathway
    102184154 (SOS2)
   04630 JAK-STAT signaling pathway
    102184154 (SOS2)
   04068 FoxO signaling pathway
    102184154 (SOS2)
   04072 Phospholipase D signaling pathway
    102184154 (SOS2)
   04151 PI3K-Akt signaling pathway
    102184154 (SOS2)
   04150 mTOR signaling pathway
    102184154 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102184154 (SOS2)
   04540 Gap junction
    102184154 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102184154 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102184154 (SOS2)
   04660 T cell receptor signaling pathway
    102184154 (SOS2)
   04662 B cell receptor signaling pathway
    102184154 (SOS2)
   04664 Fc epsilon RI signaling pathway
    102184154 (SOS2)
   04062 Chemokine signaling pathway
    102184154 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102184154 (SOS2)
   04912 GnRH signaling pathway
    102184154 (SOS2)
   04915 Estrogen signaling pathway
    102184154 (SOS2)
   04917 Prolactin signaling pathway
    102184154 (SOS2)
   04926 Relaxin signaling pathway
    102184154 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    102184154 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102184154 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102184154 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102184154 (SOS2)
   05206 MicroRNAs in cancer
    102184154 (SOS2)
   05205 Proteoglycans in cancer
    102184154 (SOS2)
   05231 Choline metabolism in cancer
    102184154 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102184154 (SOS2)
   05225 Hepatocellular carcinoma
    102184154 (SOS2)
   05226 Gastric cancer
    102184154 (SOS2)
   05214 Glioma
    102184154 (SOS2)
   05221 Acute myeloid leukemia
    102184154 (SOS2)
   05220 Chronic myeloid leukemia
    102184154 (SOS2)
   05211 Renal cell carcinoma
    102184154 (SOS2)
   05215 Prostate cancer
    102184154 (SOS2)
   05213 Endometrial cancer
    102184154 (SOS2)
   05224 Breast cancer
    102184154 (SOS2)
   05223 Non-small cell lung cancer
    102184154 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    102184154 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102184154 (SOS2)
   05160 Hepatitis C
    102184154 (SOS2)
   05163 Human cytomegalovirus infection
    102184154 (SOS2)
   05165 Human papillomavirus infection
    102184154 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102184154 (SOS2)
   01522 Endocrine resistance
    102184154 (SOS2)
Domain-containing proteins not elsewhere classified [BR:chx04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102184154 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 102184154
NCBI-ProteinID: XP_017909860
UniProt: A0A452G3I9
LinkDB
Position
10
AA seq 1332 aa
MQQAPQPYEFYSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKI
CSEEHEDRECLNQAITALMNLQGSMDRIYKQFSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
CSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIYAAKSAEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLTERFEIPEPEPTEADKLA
LEKGEQPISTDLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLEFFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGCASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSAFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDQDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPAPTGPFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVNTCPNSPN
TPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPMY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccttacgagttctacagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaaagaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtatccctatatattgtggctgtgctagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatctcaacaa
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggcgaattaaactactat
gaccttgttagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagaaagctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgagttgactgtgaaacttttaggttta
attgaagacacagttgaaatgactgatgaaagtagccctcatcccttagctggcagctgt
tttgaagatctggcagaggagcaagcatttgatccttatgaaacattatcccaggatatt
ctttcaccaaagtttaatgaacattttagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttacgtccttccacgcctt
atgctggtgccagtatatcattgttggcactattttgagttattaaagcaattgaaaata
tgtagtgaagagcatgaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatttacaagcagttttcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcagttaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagacattggacagtgttgtaat
gaatttattatggaaggcccattgacaagaattggtgctaaacacgaaaggcatattttt
ctctttgacggcttaatgatcagctgcaaacccaaccacagccagtcacgcctcccagga
tgcagcagtgcagagtacagactaaaagagaaattcgtcatgaggaagatacagatatgc
gataaagaagatacttgtgagtgcaagcacgcttttgagttagtatccaaagatgaaaac
agcataatatatgctgctaagtctgctgaagagaaaaataactggatggcagcacttatt
tcccttcagtatcgtagtactctggatcgaatgctggattcggtattattgaaggaagaa
aatgaacaaccattgagattaccaagtcctgaagtgtatcgttttgtggtgaaagactct
gaggaaaacattgtttttgaagacaacttgcagagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggctaacatatcatatgtacgcagatcccaat
tttgttcgtacctttcttactacgtaccgttcattttgtaaaccacaggaattactaagc
ttactgactgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
ttagaaaaaggcgagcagcccatcagtacagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttagggtcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagacttggagctgcttgaaagactagaattcttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaaaaaacaa
gctcaggcaaatggtataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacccttttggaatctgatctctacaggaaagttcaaccttct
gaacttgtagggagtgtatggaccaaagaagataaagaaataaactctccaaatttatta
aaaatgattcgccacaccacaaatctcaccctctggtttgaaaaatgcattgtggaggca
gaaaattttgaggaacgggtggcaatactgagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatcgtcagtgcagtaaattcagtatca
gtctatagactagatcatacctttgaggcgttgcaggaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcattttaaaaaatatctagtgaaacttaagtcaatc
aatccaccctgtgtgcctttttttggaatatatttaacaaatatactgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcaaaatcaaccttactgtttacgg
atagaaccagaaatgaggagattctttgaaaaccttaacccaatgggatgtgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcagctttctccttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttgcgaggtcacccaacaccattagaa
agagaaccgtgtaaaataagctttagtcggattgctgaaacggagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctaccccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgctcca
gtcctcttgcctcattcaaagtctttcttcagttcgtgtggtagtttacataagctaagt
gaagagccactgattcctcctccacttccacctcgaaaaaaatttgatcaggatgcttca
aattccaagggaactatgaaatctgatgatgatccccctgctattccaccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtccatttgatgggcctctg
catagtccacctccaccaccaccgagagatcctcttcctgatacccctccaccggttcca
cttcggcctccagaacactttataaactgtccgtttactcttcagccacctccactggga
catcttcacagagatccagactggttcagagacgttaatacgtgtccaaattctccgaac
actcctcctagcacaccctctccaagggtacctcgtcgatgctatgtgctcagttctagt
caaaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
catctaccaaaactgccaccaaagacttacaaacgggagctttcacaccccccaatgtat
agactgccattgttagaaaatgcagaaactcctcaatga

KEGG   Capra hircus (goat): 102185660
Entry
102185660         CDS       T02910                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04062  Chemokine signaling pathway
chx04068  FoxO signaling pathway
chx04072  Phospholipase D signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04714  Thermogenesis
chx04722  Neurotrophin signaling pathway
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04926  Relaxin signaling pathway
chx04935  Growth hormone synthesis, secretion and action
chx05034  Alcoholism
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102185660 (SOS1)
   04012 ErbB signaling pathway
    102185660 (SOS1)
   04014 Ras signaling pathway
    102185660 (SOS1)
   04630 JAK-STAT signaling pathway
    102185660 (SOS1)
   04068 FoxO signaling pathway
    102185660 (SOS1)
   04072 Phospholipase D signaling pathway
    102185660 (SOS1)
   04151 PI3K-Akt signaling pathway
    102185660 (SOS1)
   04150 mTOR signaling pathway
    102185660 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102185660 (SOS1)
   04540 Gap junction
    102185660 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102185660 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102185660 (SOS1)
   04660 T cell receptor signaling pathway
    102185660 (SOS1)
   04662 B cell receptor signaling pathway
    102185660 (SOS1)
   04664 Fc epsilon RI signaling pathway
    102185660 (SOS1)
   04062 Chemokine signaling pathway
    102185660 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102185660 (SOS1)
   04912 GnRH signaling pathway
    102185660 (SOS1)
   04915 Estrogen signaling pathway
    102185660 (SOS1)
   04917 Prolactin signaling pathway
    102185660 (SOS1)
   04926 Relaxin signaling pathway
    102185660 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    102185660 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102185660 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102185660 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185660 (SOS1)
   05206 MicroRNAs in cancer
    102185660 (SOS1)
   05205 Proteoglycans in cancer
    102185660 (SOS1)
   05231 Choline metabolism in cancer
    102185660 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102185660 (SOS1)
   05225 Hepatocellular carcinoma
    102185660 (SOS1)
   05226 Gastric cancer
    102185660 (SOS1)
   05214 Glioma
    102185660 (SOS1)
   05221 Acute myeloid leukemia
    102185660 (SOS1)
   05220 Chronic myeloid leukemia
    102185660 (SOS1)
   05211 Renal cell carcinoma
    102185660 (SOS1)
   05215 Prostate cancer
    102185660 (SOS1)
   05213 Endometrial cancer
    102185660 (SOS1)
   05224 Breast cancer
    102185660 (SOS1)
   05223 Non-small cell lung cancer
    102185660 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    102185660 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102185660 (SOS1)
   05160 Hepatitis C
    102185660 (SOS1)
   05163 Human cytomegalovirus infection
    102185660 (SOS1)
   05165 Human papillomavirus infection
    102185660 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102185660 (SOS1)
   01522 Endocrine resistance
    102185660 (SOS1)
Domain-containing proteins not elsewhere classified [BR:chx04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102185660 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102185660
NCBI-ProteinID: XP_017910637
LinkDB
Position
11
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENVQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYNYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKSTDEVPVPPPVPPRRRPESAPAESSPSKMMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcacccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaggttcatccaactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaattttgcaactattaaatatgctatgc
caagctcaaccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaatccatcctttgttaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttccgcagac
attttaaagctggtggggaattatgtgcgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgtg
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcagact
tactatgatttggtaaaagcatttatggcagaaattcgacaatacataagggagcttaat
ttaattataaaagtttttagagagccctttgtctccaattcaaagttgttttcagctaat
gatgtagaaaatatatttagtcgtatagtggatatacatgaacttagtgtaaaattactg
ggccatatagaagatactgtggaaatgacagatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattctgcgacctggttttcacgatcgtttccttagtcagttatcaaagcctggagca
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctgtttaccactgtctacattacttcgaacttctgaagcagtta
gaagaaaagagtgaggatcaagaagacaaagaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactctaacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagacta
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaagaacaattggatggcagca
ctgatatctttacagtaccggagtaccctggaaagaatgctcgacgtgaccatgctgcag
gaagaaaaggaggagcagatgaggctccctagtgctgacgtttacagatttgcagagcct
gactctgaggaaaatatcatatttgaagaaaacgtgcagcccaaagctgggattccaatt
atcaaggcaggaaccgttattaaacttatagagaggctcacataccacatgtatgcagat
cccaattttgttcggacatttcttacaacatatagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atcgctatagagaatggagaccaacccttgagtgcagaactaaaaagatttagaaaagaa
tatatacagcctgtgcagctgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattggaacc
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatgggccaggtcataatattacatttcagagttcacctcctacg
gttgagtggcacataagcagacctgggcacatcgagacttttgacctgcttaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
ctcctgaaaatgatccggcataccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaattattgagattctacaa
gtgttccaagagctcaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcccctgtttacagactagaccacacgttcgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaactaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggtatttatctcactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaacggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggcgagatccagcagtaccaaaatcagccttactgt
ttacgagtagagtcagatatcaaaaggttttttgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacggattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctcttccaagatttccaaaaaaatacaactatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtactatgagacatcccacacctctgcagcaagagcca
aggaaaattagttatagcaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagagcactgatgaagtgcctgtcccccctcctgttcctccacgaagacggccagag
tctgccccagcagaatcttcgccatctaagatgatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcctattcaccacggtattcaatatcagac
cggacctctatatcagaccctcctgagagccctcccttattacctccacgagaacccgtg
aggacacctgatgttttctcaagttcaccactacatctccaacctccccctttgggcaaa
aaaagtgaccatagtaatgccttcttcccaaacagcccctccccctttacaccacctcct
cctcaaacaccttctcctcatggaacaagaaggcatctgccgtcaccaccattgacacaa
gaagtggacctccattccattgctgggccgcctgttcctccacgacaaagcacttctcag
catatccctaaactccctccaaaaacttacaaaagggagcacacccacccgtccatgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system