KEGG   Capra hircus (goat): 102184185
Entry
102184185         CDS       T02910                                 

Gene name
CCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
chx  Capra hircus (goat)
Pathway
chx04110  Cell cycle
chx04114  Oocyte meiosis
chx04115  p53 signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04218  Cellular senescence
chx04934  Cushing syndrome
chx05161  Hepatitis B
chx05162  Measles
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05206  MicroRNAs in cancer
chx05215  Prostate cancer
chx05222  Small cell lung cancer
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102184185 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102184185 (CCNE1)
   04114 Oocyte meiosis
    102184185 (CCNE1)
   04115 p53 signaling pathway
    102184185 (CCNE1)
   04218 Cellular senescence
    102184185 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102184185 (CCNE1)
   05206 MicroRNAs in cancer
    102184185 (CCNE1)
   05203 Viral carcinogenesis
    102184185 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102184185 (CCNE1)
   05215 Prostate cancer
    102184185 (CCNE1)
   05222 Small cell lung cancer
    102184185 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102184185 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102184185 (CCNE1)
   05161 Hepatitis B
    102184185 (CCNE1)
   05162 Measles
    102184185 (CCNE1)
   05169 Epstein-Barr virus infection
    102184185 (CCNE1)
   05165 Human papillomavirus infection
    102184185 (CCNE1)
DNA replication proteins [BR:chx03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102184185 (CCNE1)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102184185 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CBM_1
Other DBs
NCBI-GeneID: 102184185
NCBI-ProteinID: XP_017917737
UniProt: A0A452FZ42
LinkDB
Position
18
AA seq 411 aa
MPREKERDAKEPDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDKTVRSQCGSQP
WDSNTACENPCSLIPTPDKEEDELLYPHAAYKPQRCTPSSSRASPLPVLNWANREEVWKI
MLNKEKTYLRDKHLMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT
QQNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKW
HLSPLTIVSWLNVYMQVAYLNDFYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFSYGVL
AASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAIVIRETGSSKLKHFRGVPAEDAHN
IQTHINSLDLLDKAQAKKAILSEENRISPLPTGVLTPPQSSKKQSSGQGSA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgccgagggaaaaggagagggatgcgaaagaaccggataccatgaaagaggaaagtggc
accgatgtctctgttcgctccaggaaaagaaaggcaaatgtagccgtttttttgcaggat
ccagatgaagaaattgccaaaattgacaagactgtgagaagccagtgtggcagtcagcct
tgggacagtaatacagcctgtgaaaacccctgctccctgattcccacacctgacaaagaa
gaggatgaacttctgtacccacacgctgcgtacaagcctcagaggtgcacgccatcgtca
tccagagcgtcgccactgcctgtactgaactgggcaaatagagaggaagtatggaaaatc
atgttaaacaaggaaaagacatacttgagggacaagcaccttatgcaacggcaccctctt
ctgcagcctaaaatgcgagcaattcttctggattggttaatggaggtatgtgaagtctat
aaacttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaaca
caacaaaatgttgtaaaaacacttttacagcttattgggatttcatctttatttattgct
gccaaacttgaggaaatctatcctccaaagttgcaccagtttgcttatgttacagatggg
gcttgttcaggagatgaaattctcaccatggaattaatcatcatgaaggcccttaagtgg
catttaagtcccctgaccattgtgtcctggttgaatgtatacatgcaggttgcatatcta
aatgatttttatgaagtgctcctgcctcagtatcctcagcaaatcttcatacagattgca
gagcttttagatctctgtgtcctggatgtcggctgcttagaattctcttatggtgtactt
gctgcttccgccttgtatcatttctcttcatccgaactgatgcaaaaggtttcagggtat
cagtggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatagttataaga
gagacaggaagttcaaaacttaagcacttcaggggagttcctgctgaagatgcacacaac
atccagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccata
ttatctgaagaaaacaggatttctcctctccccactggagtcctcaccccgccacagagc
agtaagaagcagagcagtgggcagggatcagcatga

KEGG   Capra hircus (goat): 102185672
Entry
102185672         CDS       T02910                                 

Gene name
CCNE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
chx  Capra hircus (goat)
Pathway
chx04110  Cell cycle
chx04114  Oocyte meiosis
chx04115  p53 signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04218  Cellular senescence
chx04934  Cushing syndrome
chx05161  Hepatitis B
chx05162  Measles
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05206  MicroRNAs in cancer
chx05215  Prostate cancer
chx05222  Small cell lung cancer
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102185672 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102185672 (CCNE2)
   04114 Oocyte meiosis
    102185672 (CCNE2)
   04115 p53 signaling pathway
    102185672 (CCNE2)
   04218 Cellular senescence
    102185672 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185672 (CCNE2)
   05206 MicroRNAs in cancer
    102185672 (CCNE2)
   05203 Viral carcinogenesis
    102185672 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    102185672 (CCNE2)
   05215 Prostate cancer
    102185672 (CCNE2)
   05222 Small cell lung cancer
    102185672 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102185672 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102185672 (CCNE2)
   05161 Hepatitis B
    102185672 (CCNE2)
   05162 Measles
    102185672 (CCNE2)
   05169 Epstein-Barr virus infection
    102185672 (CCNE2)
   05165 Human papillomavirus infection
    102185672 (CCNE2)
DNA replication proteins [BR:chx03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102185672 (CCNE2)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102185672 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102185672
NCBI-ProteinID: XP_017913727
UniProt: A0A452FPZ6
LinkDB
Position
14
AA seq 404 aa
MSRRSSRLQAKQQPQASQTDSPQEAQIIQAKKRKTAQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSQDVWLNMLKK
ETRYVHDKHFEVLHSELEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELAILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPAKLKIFKKISMEDRHNIQTH
TNYLAMLDEVNYVNTFRKEGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccaggccagtcagacggat
tccccgcaagaagcccagataattcaggccaagaagaggaaaacggcccaggatgtcaaa
aaaagaaaagaggaggtcaccaagaaacatcagtatgaaataaggaattgttggccacct
gtattatccggggggatcagtccttgcattatcattgaaacaccccacaaagaaatagga
acaagtgacttctccagatttacaaattatagatttaaaaatctttttattaatccttca
cctttacctgatttaagctggggatgttcacaagatgtttggctaaacatgttaaaaaaa
gagaccagatatgttcatgacaaacattttgaagttctgcattctgagttggaaccacag
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactgattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaagctccaagagtttgcttatgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaacttgctatattaaaggctttaaaatgggaactctgtcct
gtaacggtcatctcctggctaaaccttttcctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaaagttcattcaaattgctcagcttctagat
ctgtgtattttagccatcgattcattagagttccagtacagaatactggctgctgctgcc
ttgtgccactttacctctattgaagtggttaagaaagcctcaggtttggaatgggacaac
atttctgaatgtgtagactggatggtaccttttgtcagtgtagtaaaaagtactagccca
gcaaagcttaagatttttaagaagatttctatggaagacagacacaacatacagacacat
acaaattatctggctatgctggatgaagtaaattatgtaaacaccttcagaaaggaggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system