KEGG   Capra hircus (goat): 102184679
Entry
102184679         CDS       T02910                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
chx  Capra hircus (goat)
Pathway
chx04621  NOD-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102184679 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    102184679 (AIM2)
SSDB
Motif
Pfam: HIN
Other DBs
NCBI-GeneID: 102184679
NCBI-ProteinID: XP_017902028
LinkDB
Position
3
AA seq 222 aa
MCLQSEETQCEKYLWQEFDFLKGLKDNGSGCGTENLRRVKGKQEMRHAAVSTESEFFFVK
VFNKKLKDKFTPSKIIMISKYYWHSCFLEMMLISLVCGTEFDQISVSKHIIRKDGSTRKV
NKLQFQPQRTTCEWAITKSFVLILSLHRAEQKDHILCDLNDSTGTIEVLMLXKEKKIQCK
ERNKLQLTFLELSKTGEKLYLKSRVHTKWTGVIVQNVEDPDT
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgtcttcagtcagaggaaacacagtgtgaaaaatacctgtggcaggagtttgacttt
cttaagggtttgaaagacaatgggagtggctgtggcacagagaatctccgaagggtgaaa
gggaagcaggagatgcgtcatgctgcagtgtctactgagagtgaattcttttttgtaaaa
gttttcaataagaagctcaaggataaattcactccaagcaaaataattatgatatcaaaa
tattattggcacagttgtttcctggaaatgatgctgatttccctggtgtgtggcactgaa
tttgaccagatcagtgtctcaaagcatattatcagaaaagatggtagtaccagaaaggtc
aataaacttcaatttcagccccagagaacaacttgtgaatgggctattaccaaaagtttc
gtgttgattttatctttgcacagagcagaacagaaggatcatatattatgtgacctaaat
gacagcacaggaacgatagaagtattgatgcttngaaaagagaagaaaattcagtgcaag
gaacggaacaaacttcaacttacattcttagagttatcaaagactggcgaaaaactatac
ctgaaatctagagttcatacaaaatggacaggtgttattgtacagaatgtggaagaccct
gatacgtag

DBGET integrated database retrieval system