KEGG   Capra hircus (goat): 102184789
Entry
102184789         CDS       T02910                                 

Gene name
TIRAP
Definition
(RefSeq) TIR domain containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04620  Toll-like receptor signaling pathway
chx05132  Salmonella infection
chx05133  Pertussis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102184789 (TIRAP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102184789 (TIRAP)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102184789 (TIRAP)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102184789 (TIRAP)
   05133 Pertussis
    102184789 (TIRAP)
   05152 Tuberculosis
    102184789 (TIRAP)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102184789 (TIRAP)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 102184789
NCBI-ProteinID: XP_017898791
UniProt: A0A452G552
LinkDB
Position
29
AA seq 228 aa
MASSTSSPAPGSRSKKPLGKMADWFRQALSRKPTKMPASPESALSDVSQPSSLDSPPSLG
PSSEVSPIPTPSPGGASGGSGSSSSNGRWSKAYDVCVCHSEEDLVAAQELVSYLEGGAAS
LRCFLQLRDATPGGAIVSELCHALSSSHCRVLLITPGFLRDPWCRYQMLQALSEAPGAEG
RTIPLMSGLSRAAYPAELRYMYFVDGRGPERGFRQVKDAVMRYLQTLG
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcatcatcaacctcctccccggctcctggctccaggtccaagaagcctctgggcaag
atggctgactggttcaggcaggccctgtcgaggaagcccacgaagatgcccgcctcccca
gaaagcgccctcagtgacgtttcacagccgagctcactggacagccccccatccctgggc
cccagctcagaggtgtctcccatccctacaccgtcgcctgggggcgctagcggtggcagc
ggcagcagcagcagcaacggccgctggagcaaggcctatgatgtgtgcgtgtgccacagc
gaggaggacctggtggctgcccaggagcttgtctcctacctggagggcggcgccgccagc
ctgcgctgcttcttgcagcttcgcgacgccacccccggcggcgccatcgtgtccgagctg
tgccacgcgctcagcagcagccactgccgcgtgctgctgattacccccggcttcctccgg
gacccgtggtgcaggtaccagatgctgcaggcgctgagcgaggcccccggggccgagggc
cgcaccatccccctgatgtccggcctcagcagagccgcctaccccgcggagctccgatac
atgtacttcgtggacggccgcggtcccgaacgtggcttccgccaagtcaaggacgctgtc
atgcggtacctgcagacccttggctga

DBGET integrated database retrieval system