KEGG   Capra hircus (goat): 102184810
Entry
102184810         CDS       T02910                                 

Gene name
PTK2B
Definition
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
chx  Capra hircus (goat)
Pathway
chx04020  Calcium signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04670  Leukocyte transendothelial migration
chx04912  GnRH signaling pathway
chx05135  Yersinia infection
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102184810 (PTK2B)
   04072 Phospholipase D signaling pathway
    102184810 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102184810 (PTK2B)
   04670 Leukocyte transendothelial migration
    102184810 (PTK2B)
   04062 Chemokine signaling pathway
    102184810 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102184810 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102184810 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102184810 (PTK2B)
   05161 Hepatitis B
    102184810 (PTK2B)
   05163 Human cytomegalovirus infection
    102184810 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102184810 (PTK2B)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102184810 (PTK2B)
Protein kinases [BR:chx01001]
 Non-receptor tyrosine kinases
  FAK family
   102184810 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 102184810
NCBI-ProteinID: XP_005684094
LinkDB
Position
8
AA seq 1011 aa
MSRVSEALSRVKVGTLRRSEGPAEPMVVVPVDVEKEDVRILKVCFYGNSFNPGKNFKLVK
CTVQTEIREVIASILLSGRIGPNIQLADCYGLRLKHMKSDEIHWLHPLMTVGEVQDKYEC
LHVEAEWRYDLQVRYLPEDFMESLKEDKTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPRQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIIRTKKDGEKRNSLPQIPTLNLEARRPHLSESCSIESDIYAEIPDETLRRQGGPQYGI
TREDVVLNRILGEGFFGEVYEGVYTNHKGEMINVAVKTCKKDCTLDNKEKFMSEAVIMRN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPILYTLMTR
CWDYDPSERPRFTELVCSLSDIYQMEKDIALEQERNARYRPPKILEPTPFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFVRPSSREEAQQLWEAERLKMRQLLDKQQKQMVEDYQWLRQEEKALDPMVYMNDKSP
LTPEKEAGYSKSEFTAPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNEL
CQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMR
LAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLARPLAE
NT seq 3036 nt   +upstreamnt  +downstreamnt
atgtccagggtgtctgaggccctgagccgagtgaaggtgggcacattacgtcggtctgaa
ggccccgcagagcccatggtggtcgtgccagtagacgtggaaaaggaagacgtgaggatc
ctcaaggtctgcttctatggcaacagcttcaaccctgggaagaacttcaaactggttaaa
tgcactgtgcagaccgagatccgggaagtcatcgcctccatcctgctgagcgggcggatc
gggcccaacatccagctggctgactgctatgggctgaggctgaagcacatgaagtcagac
gagatccactggctacatccgctgatgacagtgggggaggtgcaggacaagtatgagtgt
ctgcatgtggaagccgagtggaggtatgaccttcaagtccgctacctgccagaggacttc
atggagagcctgaaagaggacaagaccacgctgctttatttttaccaacagctccggaac
gactacatgcagcgctatgccagcaaggtcagcgaggggatggccctgcagctgggctgt
ctggagctcaggcggttcttcaaggacatgccccacaatgcacttgacaaaaagtccaac
ttcgagctcctggagaaagaagtgggcctggacctgtttttcccaaggcaaatgcaggag
aacttaaagcccaagcagttccggaagatgatccagcagacgttccagcagtacgcctcg
ctccgggaggaggagtgcgtcatgaagttcttcaacaccctcgcaggctttgccaacatt
gaccaggagacctatcgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaaggcatccgccagctgacaagtcaagatgcaaagcccacctgcctggcc
gagttcaagcagatcaagtccatcaggtgcctccctctggaggagggccaggcggtactg
cagctgggcattgaaggcgctccccagtccttgtccatcaaaacctcctctctggcagag
gccgagaacatggctgacctcgtagatggttactgcaggctgcaaggggagcacaagggc
tctctcatcattcgaaccaaaaaagatggtgagaagcggaacagtctgccccagatcccc
acgctaaacctggaggctcggcggccccacctctcagaaagctgcagcatagaatcagac
atctatgctgagatccctgacgagaccctgcgaagacaaggaggcccacagtatggcatc
acccgggaagatgtggtcctgaatcgtattcttggtgaaggcttttttggggaggtctat
gaaggtgtctacacaaatcataaaggggagatgatcaacgtggctgtgaagacctgcaag
aaagactgcactctagataacaaggagaagttcatgagtgaggcagtgatcatgaggaac
ctggaccacccacacattgtgaagctgatcggcatcattgaagaggagcccacctggatc
atcatggaactgtacccctacggggagctgggccactacctggagcgaaacaagaacagc
ctgaaggtgctcactcttgtcctgtactcgctgcagatctgcaaggccatggcctacctg
gaaagcatcaactgtgtccacagggacattgctgtccggaacatcctggtagcctccccg
gagtgtgtgaagctgggggactttggcctttcccgatacattgaggatgaggagtattac
aaagcctctgtgacccgtctgccaatcaaatggatgtcccctgagtccatcaacttccgc
cgcttcacgactgccagcgatgtctggatgtttgctgtgtgcatgtgggaaatcctgagc
ttcggaaagcagcccttcttctggttggagaacaaggatgtcattggggtgctggaaaag
ggggaccggctgcccaagcctgacctctgcccgcccattctctacaccctcatgacccgc
tgctgggactatgaccccagtgaacgaccccgcttcaccgagctcgtgtgcagcctcagt
gacatttaccagatggagaaggacatcgccttagagcaggagaggaacgctcgctaccga
cctcccaaaatcttagagcccacacccttccaggaacccccacccaagcccagccgaccc
aagtacagaccccctccacaaaccaaccttctggcacccaagctgcaattccaggtccct
gagggtctgtgtgccagctcacccacgctcaccagccctatggagtatccatctcctgta
aactcgctgcacaccccacctctccaccggcacaatgtcttcaagcgccacagcatgcgg
gaggaggactttgtccggcccagcagccgggaggaggcccagcagctgtgggaggccgag
aggctcaagatgcggcaactgctggacaagcagcagaagcagatggtggaagattaccag
tggctgaggcaggaggagaaagccctggaccccatggtttacatgaacgacaagtcccca
ttgaccccagagaaggaggccggctacagtaagtcggagttcacagcccccccgcagaaa
ccaccacggctcggcgcacagtccatccagcccacagccaacctggatcggaccgacgac
ctggtgtacctcaacgtcatggagctggtgcgggctgtgctggatctcaagaatgagctc
tgccagctgcctcccgagggctacgtggtggtggtgaagaatgtgggcctgaccctgcgg
aagctcatcggcagtgtggatgacctcctgccctccttgccgtcgtcttcacggacagag
atcgaggggacccagaaactgctgaacaaggaccttgcggaactcatcaataagatgcga
ctggcccagcagaacgctgtgacttccctgagtgaggagtgcaagcggcagatgctcacc
gcctcccacacgctggccgtggacgccaagaacctgctggacgccgtggaccaagccaag
gtcctggccaacctggcccgcccactggcagagtga

DBGET integrated database retrieval system