KEGG   Capra hircus (goat): 102184834
Entry
102184834         CDS       T02910                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102184834 (CACNA1E)
   04020 Calcium signaling pathway
    102184834 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102184834 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:chx04040]
    102184834 (CACNA1E)
Ion channels [BR:chx04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102184834 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 102184834
NCBI-ProteinID: XP_017916169
LinkDB
Position
16
AA seq 2218 aa
MILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKG
SYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGC
PAGYECRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIP
LIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEV
MLAEENKNAGTSALEVLRRATIKRSRTEAMARDSSDEHCVDISSVGTPLARASIKSAKVD
GASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEF
LFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRA
LRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFND
GTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYT
LLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRR
HHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNP
LSPLNPLSAHPSLYRRPRAIEGLALGLGLEKCEEERVSRGGSLKGDGGDLASALDSQRSP
LALGKREPPWLARPCHGNCDPTQPEAGGGETVVTFGDRARHRQSQRRSRHRRVRTEGREP
SSASRSRSASQERSLDETVPSEGERDREPRAGHGGKEPMIREEERGRCQDLRRTNSLMVP
RGSGLAGALDEADTPLVPPQPELEVGKDAALTEQEPEGSSEQALLGDVKLDMGRVSQSEP
DLSCVTANTDKATTESTSVTVTIPDVGPLVDSTMVHISNKTDGEASPLKEEEIREDEEEV
EKKQQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALA
AEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVV
GALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFN
ILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTQRECIGNYVDHEKNKMEVKGREWKRH
EFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFP
FFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRV
WHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIA
FGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGY
TIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFG
SLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQSESERCGTDLAYVYFVSFIFFCS
FLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIPYKDMYKLVRVI
SPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQL
DSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYRQSKVKKQRQQLE
EQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVPGLSGRSAYPSMSPLSPQEIFQLAC
MDPADDGQFQEQQSLEPEVSELKSVQPSNHGIYLPSDTQEHAGSGKASSMPRLTVDPQVV
TDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGH
KSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPN
RQGTGSLSESSIPSISDSSTPRRSRRQLPPVPPKPRPLLSYSSLMRHAGSISPPADGSEG
GSPLTSQALESNDAGLPESSNPRQGHPSPQRYISEPYLALHEDSHASDCGEEETLTFEAA
VATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMTCGAVSDLLSDTEEDDKC
NT seq 6657 nt   +upstreamnt  +downstreamnt
atgatcttggccaccatcattgccaattgcatcgtcttggccctggagcaacatcttcct
gaggatgacaagaccccaatgtcccgcagactggagaagacagaaccctatttcattggg
atcttttgctttgaagctgggatcaaaatcgtggccctggggttcatcttccataagggc
tcgtacctccgcaatggctggaatgtcatggacttcatcgtggtcctcagcggcatcctg
gctactgcgggaacccacttcaacacccatgtggacctgaggaccctccgggccgtgcgt
gtcctgaggcccctgaagctcgtgtcggggatacctagcctacagattgtgttgaagtcc
atcatgaaggccatggtgcctctcctgcagattggccttctgctcttctttgccatcctg
atgtttgctatcatcggcttggagttctacagtggaaagttgcaccgagcctgcttcatg
aataattcaggtattctagaaggatttgacccgcctcacccatgtggcgtgcagggctgc
ccagctggttatgaatgccgggactggatcggccccaatgatgggatcacccagtttgat
aacatcctttttgctgtgctgactgtcttccagtgcatcaccatggaagggtggactacc
gtgctgtacaataccaatgatgccttaggagccacctggaattggctgtacttcatcccc
ctcatcatcattggatccttttttgttctcaacctcgtcctgggagtgctttccggggaa
tttgccaaagagagagagagagtggagaaccggagagcctttatgaaactgcggcgccag
cagcagatcgagcgtgagctgaacgggtaccgcgcctggatagacaaagcagaggaagtc
atgcttgctgaagaaaacaaaaatgctggaacgtcagccttagaagtgcttcggagggca
accatcaaaaggagccggactgaggccatggcacgggactccagcgacgagcactgtgtg
gacatctcctctgtgggcacacctcttgcccgagccagcatcaagagcgcaaaggtggac
ggggcctcctatttccggcacaaggagcgacttttgcgtatctctatccgccacatggtg
aagtcccaggtgttttactggatcgtgctgagccttgtggctctcaacaccgcctgtgtg
gccatcgtccaccacaaccagccccagtggctcacccacctcctctactatgcagagttt
ctgtttctggggctcttccttctagagatgtccctgaagatgtatggcatggggcctcgc
ctttattttcactcttccttcaactgctttgactttggggtcacagtgggcagcatcttt
gaagtagtctgggccatcttcagacctggtacatctttcggaatcagtgtcctgcgagct
ctccggcttctaagaatatttaaaataaccaagtattgggcatccctccggaatttggtg
gtctccttgatgagctccatgaaatctatcatcagtttactcttcctcctcttcctcttc
atcgttgtctttgctctgctaggaatgcagctgtttgggggcagattcaactttaatgat
gggactccttcagcaaacttcgacaccttccctgcagccatcatgactgtattccagatc
ctgacgggtgaggactggaatgaggtgatgtacaatgggatccgctcccagggtggggtc
agctcgggcatgtggtctgctatctatttcattgtgctcaccttgtttggaaactacaca
ctgctgaatgtgttcttggccatcgctgtggacaatctggccaacgcccaggagctgacc
aaggatgaacaagaagaagaggaggccttcaaccagaagcatgcgctgcagaaggccaag
gaggtcagcccgatgtctgcacccaacatgccttccatcgaaagagacagaaggagaaga
caccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcac
cacatgtccgtgtgggagcagcgaaccagccagctgaggaggcacatgcagatgtccagc
caggaggccctcaacaaggaggaggccccgcccatgaaccccctcaaccccctcaacccg
ctgagccccctcaacccgctcagcgcgcaccccagcctctaccggaggccccgggccatc
gaggggctggccctgggcctggggctggagaagtgtgaggaagagcgcgtcagccgcggg
gggtccctcaagggggacggaggggacttggcgagcgccctggacagccagaggagcccc
ctggccctgggcaaacgggagccaccctggctggcccggccctgtcacgggaactgcgac
ccgacccagccggaggcgggcggcggggagacggtggtgaccttcggggaccgggcccgg
cacaggcagagccagcggcgcagccggcaccgccgcgtcaggaccgagggcagggagccc
tcctccgcctccaggagcaggtctgccagccaggagcggagtctggacgaaactgtgccc
agcgagggcgagagggaccgcgagcccagggccggccacgggggcaaagaacccatgatc
cgagaggaagagcgagggcgatgccaggacttacggaggaccaacagtctgatggtgccc
agaggctccgggctggcaggagccctggatgaggctgacacaccccttgtcccaccccag
ccagagctggaagtggggaaggacgcagccctgacggagcaggagccagagggcagcagt
gagcaggctctgctgggggacgtgaagctggatatgggccgggtcagccagagcgaacct
gacctctcctgcgtcacggccaacacggacaaggccaccaccgagagcaccagcgtcact
gtcaccatccccgacgtgggccccttggtggattcaaccatggtgcacatcagcaacaag
actgatggagaagccagtcccttgaaagaggaagagatcagagaggatgaagaggaggta
gagaagaagcagcagaaaaaggagaagcgtgagacgggcaaagccatggtgccccacagc
tcgatgttcatcttcagcaccaccaacccgatccgcagggcctgccactacatcgtgaac
ctgcgctacttcgagatgtgcatcctgctggtgattgcagccagcagcatcgccctggcg
gctgaggaccccgtcctgaccaactcggagcgcaacaaagtgctgaggtactttgactac
gtgttcactggcgtgttcacctttgagatggttataaagatgatagaccagggcttgatt
ctgcaggacggctcctacttccgagacctgtggaacatcctggacttcgtggtggtggtt
ggtgcattggtggcctttgctctggcgaatgctttgggaaccaacaagggccgggatatc
aagaccatcaagtctctgagggtgctccgtgtcctgaggccgctgaagaccatcaagcgc
ttgcccaagctcaaggctgtcttcgactgtgtggtcacctccttgaaaaacgtcttcaac
atactcattgtctataagctcttcatgttcatctttgctgtcatcgcggttcagcttttc
aagggcaagttcttctactgcacggacagttccaaggacacacagagggagtgcataggc
aactatgtagatcatgagaaaaacaagatggaggtgaaaggccgagagtggaagcgccat
gaattccattatgacaacatcatctgggctctgctgactctcttcactgtctccacaggg
gaaggatggcctcaagtcttgcagcactcggtcgatgtgacggaggaagaccgaggcccg
agccgcagcaaccggatggagatgtccatcttttacgtggtctacttcgtggtcttccct
ttcttctttgtcaacatctttgtggctctcatcatcatcaccttccaggagcaaggggac
aagatgatggaagagtgcagcctggagaagaacgagagggcgtgcatcgacttcgccatc
agcgccaaaccgctcacccgctacatgccccagaacaggcacacctttcagtaccgcgtc
tggcacttcgtggtgtctccatcctttgagtacaccatcatggccatgatcgccctgaac
accgtcgtgctgatgatgaagtactactctgctccctgtacctatgagctggccctgaag
tacctaaatatcgccttcaccatggtgttttccctggagtgtgtcctgaagatcattgca
tttggcttcttgaactatttccgagacacctggaatatctttgacttcatcactgtgatt
ggcagtatcacagaaattattctgacggacagcaagctggtgaacacgagtggcttcaac
atgagctttctgaagctcttccgggcggcccgcctcatcaagctgctgcgtcagggctac
accatccgcattttactgtggaccttcgtgcagtcctttaaggcccttccctatgtctgc
cttctgatcgccatgcttttcttcatctatgccatcattgggatgcaggtctttggaaac
ataaagttagatgaagagagtcatatcaaccggcacaacaacttccggagcttctttggg
tccctcatgctgctcttcaggagtgccacgggtgaggcctggcaggagataatgctgtcg
tgtctcggggagaagggctgtgagccggacaccactgcgccatcggggcagagcgagagc
gagcgctgtggcaccgacctggcctacgtgtacttcgtctccttcatcttcttctgctcc
ttcctgatgctcaacctattcgtggctgtcatcatggacaactttgagtacctgactcgg
gactcatccatcctggggcctcaccacctggatgagtttgtccgtgtctgggcagagtat
gacagagcagcatgtggcaggatcccgtataaggatatgtacaaattagtgcgggtgatc
tcgccgcctctgggcctgggagagaactgcccctacagggtggcttgcaagaggttggtc
ttgatgaacatgccagtggctgaggacatgactgtccacttcacttccacactgatggct
ctaatccggacagctctggacattaaaatcgccaaaggtggtgcagacaggcagcagcta
gactcagagctccagaaggagaccctggccatctggcctcacctgtcccagaagatgctg
gatctgctcgtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagca
atgatgatcatggactactacagacagagcaaggtgaagaagcagaggcagcagctggag
gaacagaaaaatgcacccatgttccagcgcatggagccctcatctctgcctcaggagatc
attgctaatgccaaagccctgccttatctccagcaggaccccgtgccaggcctgagtggc
cggagtgcatacccttcgatgagtccactctccccacaggaaatattccagttggcctgt
atggacccagctgatgatggacagttccaggaacaacaatctctggagccagaggttagt
gaattaaaaagcgtgcagccctctaaccatggcatctaccttccttcggacacccaggag
catgcgggctctgggaaggcatcctctatgccacgcctgactgtggatccccaggtggtg
acagaccccagctccatgagacgttcattttccaccattcgtgataagcgttcaaattcc
tcgtggctggaggaattctccatggagcggagcagcgaaaacacctacaagtcacggcgc
cggagttaccactcctccctgaggctgtcagcccaccgtctgaactctgactcaggccac
aagtctgacacccaccgctccgggggcagagagcggggacgatcgaaagagcgaaagcat
cttctctctcctgacgtctcccgctgcaactccgaggagcgagggacccaggccgactgg
gagtccccagagcgccgtcagtcccggtctcccagtgaaggcaggtcacagacccccaac
agacagggcacggggtccctgagtgagagctccatcccctccatctccgactccagcacc
ccacgacgaagtcggcggcagctcccaccggtccctcccaagcctcggcccctcctttcc
tacagctctctgatgagacacgctgggagcatctccccaccagctgatgggagcgagggt
ggctccccactgacctcccaagctctggagagcaacgatgccggcctgcccgagtcttcc
aacccccggcagggccacccctccccacagcgctacatctccgagccctacctggccctg
cacgaagactcccacgcctcggactgcggcgaggaggagacgctcacctttgaagcagcc
gtggccaccagcctgggccggtccaacaccattggctcggccccgcccctgcggcacagc
tggcagatgcccaacgggcactatcggcggcggaggcgcggggggcctggaccgggcatg
acgtgcggagctgtcagcgacctcctgagtgacacggaagaagacgacaagtgctag

DBGET integrated database retrieval system