KEGG   Capra hircus (goat): 102185021Help
Entry
102185021         CDS       T02910                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
chx  Capra hircus (goat)
Pathway
chx00480  Glutathione metabolism
chx00980  Metabolism of xenobiotics by cytochrome P450
chx00982  Drug metabolism - cytochrome P450
chx00983  Drug metabolism - other enzymes
chx01524  Platinum drug resistance
chx05200  Pathways in cancer
chx05204  Chemical carcinogenesis
chx05225  Hepatocellular carcinoma
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102185021 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102185021 (MGST2)
   00982 Drug metabolism - cytochrome P450
    102185021 (MGST2)
   00983 Drug metabolism - other enzymes
    102185021 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102185021 (MGST2)
   05204 Chemical carcinogenesis
    102185021 (MGST2)
   05225 Hepatocellular carcinoma
    102185021 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102185021 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    102185021 (MGST2)
Enzymes [BR:chx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102185021 (MGST2)
Transporters [BR:chx02000]
 Other Transporters
  Pores ion channels [TC:1]
   102185021 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102185021
NCBI-ProteinID: XP_005691288
LinkDB All DBs
Position
17
AA seq 146 aa AA seqDB search
MAGNSILLAALSVLSACQQSYFAMQVGKARSKYKVMPPSVSGSPDFERIFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYSRHQYFWGYAEAAKKRITGFRLSLGVLALLTV
LGAVGILNSFLDEYLDIDIAKKLRHF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaattcgatattgctggctgcactctctgtcctctcagcctgtcagcaaagt
tattttgctatgcaggtaggaaaggcgagatcgaaatacaaagttatgcccccatccgtc
tctgggtcgccagattttgagagaatatttcgtgcacagcaaaactgtgtggagttttac
ccaatattcataatcacattgtggatggctggatggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatctattcccgtcaccagtatttctggggatatgcagaagct
gctaaaaaaaggatcactggtttccggctgagtctgggggttttggccttgttgactgtc
ctaggtgccgtggggattttgaacagctttctggatgaatacctggacatcgatattgcc
aagaaactgaggcacttctaa

DBGET integrated database retrieval system