KEGG   Capra hircus (goat): 102185338
Entry
102185338         CDS       T02910                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
chx  Capra hircus (goat)
Pathway
chx00220  Arginine biosynthesis
chx00330  Arginine and proline metabolism
chx01100  Metabolic pathways
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04066  HIF-1 signaling pathway
chx04071  Sphingolipid signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04611  Platelet activation
chx04915  Estrogen signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04931  Insulin resistance
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102185338 (NOS3)
   00330 Arginine and proline metabolism
    102185338 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102185338 (NOS3)
   04371 Apelin signaling pathway
    102185338 (NOS3)
   04066 HIF-1 signaling pathway
    102185338 (NOS3)
   04020 Calcium signaling pathway
    102185338 (NOS3)
   04071 Sphingolipid signaling pathway
    102185338 (NOS3)
   04022 cGMP-PKG signaling pathway
    102185338 (NOS3)
   04151 PI3K-Akt signaling pathway
    102185338 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102185338 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102185338 (NOS3)
   04921 Oxytocin signaling pathway
    102185338 (NOS3)
   04926 Relaxin signaling pathway
    102185338 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102185338 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102185338 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102185338 (NOS3)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102185338 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102185338
NCBI-ProteinID: XP_017902213
LinkDB
Position
4
AA seq 1205 aa
MGNLKSVGQEPGPPCGLGLGLGFGLCGKQGPASPAPEPSRAPAPATPQAPDHSPAPSSPT
LTRPPEGPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLVLPRKLQTRPSQGPP
PAEQLLSQARDFINQYYSSIKRSSSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGR
GDFRIWNTQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWAPGNGRFDVLPLLLQAPDE
APELFVLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIV
DHHAATVSFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPD
PWKGSAAKGAGITRKKTFKEVANAVKISASLMGTLMAKRVKATILYASETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAKAAFQASCETFCVGEEAKA
AAQDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRAT
ILVRLDTAGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPTESVAVEQLEKGSPG
GPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEVHLTVA
VLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPYVPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQERGVFGRVLTAFS
REPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGGME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPPGP
DTPGP
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggcaacctgaagagtgtgggccaggagcccgggcccccctgtggcctggggctgggg
ctgggtttcgggctatgtggcaagcagggcccggcctccccagcacctgagcccagccgg
gcccccgcacccgccaccccgcaagcaccagaccacagcccagctcccagcagccccacg
ctgacccggcctccggaggggcccaagttccctcgtgtgaagaactgggagctggggagc
atcacctacgacaccctgtgcgcgcagtcccagcaggacgggccctgcacccccagacgc
tgcctcggctccctggtgttgccccggaaactgcagactcggccctcccaaggacctcca
cccgctgagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatt
aagaggagcagctcccaggctcatgaggagcggcttcaggaggtggaggccgaggtggca
tccacgggcacctaccacctccgagagagcgagctggtgttcggggccaagcaggcctgg
cgcaacgcgccccgctgtgtgggccgcatccagtgggggaagctgcaggttttcgatgcc
cgggactgcagctcagcacaggagatgttcacctacatctgcaaccacatcaagtacgcc
accaaccgtggcaaccttcgctcggccatcacagtgttcccgcagcgcgccccgggccgc
ggagacttccggatctggaacacccagctggtgcgctacgcaggctacagacagcaggac
ggctctgtgcgtggggacccagccaacgtggagatcacggagctctgcatccagcacggc
tgggcccccggaaacggccgcttcgacgtgctgcccctgctgctccaggccccagatgag
gctccagagctctttgttctgccccccgagctggtcctcgaagtgcccctggagcacccc
acactggagtggttcgcggccctgggcctgcgctggtatgccctcccggccgtgtccaac
atgctgctggaaatcgggggtctggagttccccgcggcccccttcagcggctggtacatg
agcacggagattggcacgcggaacctgtgtgaccctcaccgctacaacatcctggaggat
gtggctgtctgcatggacctcgacacacggaccacctcgtccctgtggaaggacaaggca
gccgtggagatcaacctggctgtgctgcacagctttcagctcgccaaggtgaccatcgtg
gaccaccacgccgccacagtgtccttcatgaagcacctggaaaacgagcagaaggccaga
gggggctgccccgccgactgggcctggatcgtgccccccatctcgggcagcctcacgcca
gtcttccaccaggagatggtcaattacgtcctgtcccctgccttccgctatcagccagac
ccctggaaggggagcgcggccaagggcgccggcatcaccaggaagaagacctttaaggaa
gtggccaacgcggtgaagatctctgcctcactcatgggcaccctgatggccaagcgagtg
aaagcaaccatcctgtacgcctctgagaccggccgggcccagagctatgctcagcagctg
gggaggctcttccggaaggcctttgacccccgggtcctgtgcatggatgagtatgacgtg
gtgtccctggagcacgaggcgctggtgctggtggtgaccagcacctttgggaatggcgat
cccccggagaatggagagagttttgcagctgccctgatggagatgtcggggccctacaac
agctccccgaggccggaacagcacaagagttacaagatccgcttcaacagcgtctcctgc
tccgacccgctggtgtcctcctggcggcggaagagaaaggagtccagcaacacagacagc
gcgggggccctggggaccctcaggttctgtgtgtttggactgggctcccgggcgtacccc
cacttctgcgccttcgcgcgtgcagtggacacccggctggaagagctgggaggggagcgg
ctgttgcagctgggccagggcgacgagctctgcggccaggaggaggccttccgtggctgg
gcaaaggcggccttccaggcctcctgcgagacgttctgcgtcggggaggaggccaaggcc
gccgcccaggacatcttcagccccaaacggagctggaaacgccagaggtaccggctgagc
gcccaggccgagggcctccagctgctgccaggcctgatccacgtgcacagacggaagatg
tttcaggccacagtcctctcagtggaaaacctgcaaagcagcaagtccacccgggccacc
atcctggtgcgcctggacaccgcaggccaggaggggctgcagtaccagccgggggaccac
ataggcatctgcccgcccaaccggccgggcctcgtggaggcgctgctgagccgcgtggag
gacccaccgccgcccaccgagtctgtggctgtggagcagctggagaagggcagcccaggc
ggccctcctcccagctgggtgcgggacccgcggctgcccccgtgcacactgcgccaggct
ctcaccttcttcctggacatcacctccccgcccagcccccggcttctccgactgctcagc
accctggccgaagaacccagcgaacagcaggagctcgagaccctcagtcaggacccccgg
cgctacgaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttc
ccatccgtggcactgcccgccccactgctcctcacccagctgcccctgctgcagcccagg
tactactccgtcagctcggcccccagcgcccaccccggagaggtccacctcacggtggct
gtgctggcgtacaggacccaagatgggctgggccccctacactacggggtctgctccacg
tggctgagccaactcaagactggagacccagtgccctgcttcatcaggggggctccctct
ttccggctgccgcctgacccctacgtgccctgcatcctcgtgggccccggcactggcatc
gcccccttccggggattttggcaggagcggctgcatgacattgagagcaaagggctgcag
cccgcccccatgaccctggtgttcggctgccggtgctcccaactcgaccatctctaccgc
gacgaggtgcaggacgcccaggagcgcggggtgtttggccgcgtcctcaccgccttctcc
cgggaacctgacagccccaagacctacgtacaggacatcctgagaaccgagctggctgcc
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgacgtcact
atggcaaccagcgtcctgcagacggtgcagcgcatcttggcgacagagggcggcatggag
ctggacgaggcgggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
atttttggcctcacgctgcgcacccaggaggtgacaagccgcatacgtacccagagcttt
tccctgcaggagcggcatctgcggggcgcggtgccctgggccttcgacccgccaggccca
gacacccccggcccctga

DBGET integrated database retrieval system