KEGG   Capra hircus (goat): 102185423
Entry
102185423         CDS       T02910                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04024  cAMP signaling pathway
chx04137  Mitophagy - animal
chx04210  Apoptosis
chx04310  Wnt signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04530  Tight junction
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05030  Cocaine addiction
chx05031  Amphetamine addiction
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05161  Hepatitis B
chx05162  Measles
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05224  Breast cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
chx05323  Rheumatoid arthritis
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102185423 (JUN)
   04012 ErbB signaling pathway
    102185423 (JUN)
   04310 Wnt signaling pathway
    102185423 (JUN)
   04668 TNF signaling pathway
    102185423 (JUN)
   04024 cAMP signaling pathway
    102185423 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102185423 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    102185423 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102185423 (JUN)
   04530 Tight junction
    102185423 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102185423 (JUN)
   04621 NOD-like receptor signaling pathway
    102185423 (JUN)
   04625 C-type lectin receptor signaling pathway
    102185423 (JUN)
   04660 T cell receptor signaling pathway
    102185423 (JUN)
   04658 Th1 and Th2 cell differentiation
    102185423 (JUN)
   04659 Th17 cell differentiation
    102185423 (JUN)
   04657 IL-17 signaling pathway
    102185423 (JUN)
   04662 B cell receptor signaling pathway
    102185423 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102185423 (JUN)
   04915 Estrogen signaling pathway
    102185423 (JUN)
   04921 Oxytocin signaling pathway
    102185423 (JUN)
   04926 Relaxin signaling pathway
    102185423 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102185423 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102185423 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185423 (JUN)
   05203 Viral carcinogenesis
    102185423 (JUN)
   05231 Choline metabolism in cancer
    102185423 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102185423 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102185423 (JUN)
   05211 Renal cell carcinoma
    102185423 (JUN)
   05224 Breast cancer
    102185423 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102185423 (JUN)
   05321 Inflammatory bowel disease
    102185423 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    102185423 (JUN)
   05031 Amphetamine addiction
    102185423 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102185423 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102185423 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102185423 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102185423 (JUN)
   05135 Yersinia infection
    102185423 (JUN)
   05133 Pertussis
    102185423 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102185423 (JUN)
   05170 Human immunodeficiency virus 1 infection
    102185423 (JUN)
   05161 Hepatitis B
    102185423 (JUN)
   05171 Coronavirus disease - COVID-19
    102185423 (JUN)
   05162 Measles
    102185423 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102185423 (JUN)
   05169 Epstein-Barr virus infection
    102185423 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102185423 (JUN)
   05142 Chagas disease
    102185423 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102185423 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102185423 (JUN)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    102185423 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 102185423
NCBI-ProteinID: XP_017900231
UniProt: A0A452DQ92
LinkDB
Position
3
AA seq 335 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMP
GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS
TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg
aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc
ctcacctcgcccgacgttgggctgctcaagctggcgtcgcccgagctggagcgcctcatc
atacagtccagcaacgggcatatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg
ggcctggtggccccggcggtggcctcggtggcgggcggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggctggcctggcctttcccgcgcag
ccccagcagcagcagcagcaaccgccgcagccaccgcaccacctgccccagcagataccc
gtgcagcacccgcggctgcaggccctgaaggaagagccgcagacggtgcccgagatgccc
ggggaaacgccgcccctgtcccccatagacatggagtcccaggagcggatcaaggcggag
aggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagagg
atcgcgcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtcc
actgccaatatgctcagggaacaggtggcccagcttaaacaaaaagtcatgaaccacgtt
aacagcgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system