Capra hircus (goat): 102185860 Help Entry 102185860         CDS       T02910                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04020   Calcium signaling pathway chx04151   PI3K-Akt signaling pathway chx04714   Thermogenesis chx04810   Regulation of actin cytoskeleton chx05200   Pathways in cancer chx05218   Melanoma chx05224   Breast cancer chx05226   Gastric cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102185860 (FGF21)    04014 Ras signaling pathway     102185860 (FGF21)    04015 Rap1 signaling pathway     102185860 (FGF21)    04020 Calcium signaling pathway     102185860 (FGF21)    04151 PI3K-Akt signaling pathway     102185860 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102185860 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     102185860 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102185860 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     102185860 (FGF21)    05218 Melanoma     102185860 (FGF21)    05224 Breast cancer     102185860 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102185860 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     102185860 (FGF21) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Growth factors (RTK binding)    102185860 (FGF21) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Growth factors/receptors    102185860 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Putative_PNPOx Motif Other DBs NCBI-GeneID:  102185860 NCBI-ProteinID:  XP_005692745 EnsemblRapid:  ENSCHIG00000025254 UniProt:  A0A0U2UQ40 LinkDB All DBs Position 18:56403257..56405520 Genome browser AA seq 209 aa AA seqDB search MGWDEAKFKHLGLWVPVLAVLLLGTCRAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH LEIRADGTVVGAARQSPESLLELKALKPGVIQIFGVKTSRFLCQGPDGKLYGSLHFDPKA CSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPPAPPDPPGI LAPEPPDVGSSDPLSMVGPSYGRSPSYTS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggacgaggccaagttcaagcacttgggactgtgggtccctgtgctggctgtc ctcctgctaggaacctgccgggcgcatcccattccagactccagccccctcctccagttt gggggccaagtccgccagcggtacctctacacggatgatgcccaggagacagaggcccac ctggagatcagggccgatggcacagtggtgggggcggcccgccagagtcccgaaagtctc ttggagctgaaagccctgaagccaggcgtcattcagatctttggagttaaaacatccagg ttcctgtgccaggggccagatgggaagctgtacggatcgctgcactttgaccccaaagcc tgcagcttccgggagctgcttcttgaagatgggtacaatgtctaccagtcggagaccctg ggccttccactccgcctgcccccgcagcgctcatccaaccgggacccggccccgcgggga cctgctcgcttcctgccgctgccaggcctgcccccggcgcccccggatcctccagggatc ttggcccccgagcctcccgacgtgggctcctcggatcccctgagtatggtgggaccctcg tatggccgaagccccagctacacttcttga

DBGET integrated database retrieval system