KEGG   Capra hircus (goat): 102185926
Entry
102185926         CDS       T02910                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04915  Estrogen signaling pathway
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05223  Non-small cell lung cancer
chx05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102185926 (TGFA)
   04012 ErbB signaling pathway
    102185926 (TGFA)
   04014 Ras signaling pathway
    102185926 (TGFA)
   04151 PI3K-Akt signaling pathway
    102185926 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102185926 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185926 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102185926 (TGFA)
   05212 Pancreatic cancer
    102185926 (TGFA)
   05225 Hepatocellular carcinoma
    102185926 (TGFA)
   05214 Glioma
    102185926 (TGFA)
   05211 Renal cell carcinoma
    102185926 (TGFA)
   05215 Prostate cancer
    102185926 (TGFA)
   05223 Non-small cell lung cancer
    102185926 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102185926 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 102185926
NCBI-ProteinID: XP_005686442
LinkDB
Position
11
AA seq 160 aa
MVTSAGQLALFALGIFLAVCQALENSTSALSADPPVAAAVVSHFNDCPASHSQFCFHGTC
RFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCEVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctcttcgcgctgggtattttcttggccgtgtgc
caggccctggagaacagcacatccgccctgagtgcagacccgcccgtggctgcagctgtg
gtgtcccattttaatgactgcccagcttcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggagaagccagcgtgtgtctgccactctgggtacgtcggtgca
cgctgtgaacacgcagacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtcctcatcatcacatgtgtgctg
atacactgctgtgaggtccgaaaacactgtgagtggtgccgggcgctcatctgccggcat
gagaagcccagcgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system