KEGG   Capra hircus (goat): 102185959
Entry
102185959         CDS       T02910                                 

Gene name
TANK
Definition
(RefSeq) TRAF family member associated NFKB activator
  KO
K12650  TRAF family member-associated NF-kappa-B activator
Organism
chx  Capra hircus (goat)
Pathway
chx04140  Autophagy - animal
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx05014  Amyotrophic lateral sclerosis
chx05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102185959 (TANK)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102185959 (TANK)
   04622 RIG-I-like receptor signaling pathway
    102185959 (TANK)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102185959 (TANK)
   05022 Pathways of neurodegeneration - multiple diseases
    102185959 (TANK)
SSDB
Motif
Pfam: TBD FliD_N PKcGMP_CC
Other DBs
NCBI-GeneID: 102185959
NCBI-ProteinID: XP_005676113
LinkDB
Position
2
AA seq 433 aa
MKLLHGALPSHRSVIYSIIYSDATGHRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQ
KQTEDYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSSRDNSCGYIPLLEDSEARKNNLTL
EQPHDKPKSGIPRENESKVRRQEVSSPRKETSPRSLSTPLFHESYIEKTFWDLKEEFHRL
CLLAKAQKDHLSKLNVPTTATETQCSMPIQCTDKTDKQEVLFKPQAKDDINRGAPCVTSV
TPRGLGQDEEDTSFESLSKLNVKFPPTDNDSTFLHSTPERPDVLGSVTSETVCQDQFNME
PRDNPGNFVKTGETLFEIQGIDPIASAIQNLKTTDKTKPSNTCIRTSLDRAPCLPPGDHN
ALFVNTFPLQDPSDAPFPSLDSPGKAIRGPQQSVQSCFSRWHPALCICFLCYSKGNSCPF
GSPFLIKTVTYWY
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaactccttcacggcgctctccccagccacagatctgtcatttactccatcatttat
agtgatgcaacaggacatagaggaatggataaaaacattggcgagcaactcaataaagct
tatgaagcctttcgacaggcatgcatggatagagattctgcagtaaaagaactacagcaa
aagcagactgaagactatgagcagagaatacgtgagcaacaggaacagctgtcacttcaa
caaactattattgacaagctaaaatcacagttacttcttgtgaattccagtcgagataac
agttgtggctatattcccctacttgaagacagtgaagcaaggaagaataatttgactctt
gaacagcctcatgataaaccaaaatcaggaataccaagagaaaacgaatcaaaggtaaga
agacaagaggtttcctctccaagaaaagaaacttcaccaaggagtcttagcactccttta
ttccatgaaagctatatagagaagactttctgggatctgaaagaagaatttcatagacta
tgcttgctagctaaagcacaaaaagaccacttaagcaaacttaatgtaccaaccactgca
actgagacacagtgctctatgcctatacagtgtacggataaaacagataaacaagaagtg
ctgtttaagcctcaggcaaaagatgatataaatagaggtgcaccgtgcgtcacatctgtc
acaccaagaggactgggccaagatgaggaagacacatcttttgaatcactttctaaattg
aatgtcaagtttccacctacggacaatgactctactttcttacatagcactccagaaaga
cctgatgtccttggttctgtcacatctgagactgtgtgccaggatcaatttaatatggag
cccagagacaatccaggaaactttgtcaaaacaggagaaactttatttgaaattcaggga
attgaccccatagcttcagctatacaaaaccttaaaacaactgacaaaacaaaaccctca
aatacttgtattaggacatctctggatagagctccgtgtttgccacctggagaccataat
gcattatttgtaaatacattcccacttcaggacccatctgatgcaccttttccttcactg
gattccccaggaaaagctatccgaggaccacagcagtctgtgcagtcatgtttcagtaga
tggcaccctgcattgtgcatttgctttctgtgctacagcaagggaaacagctgcccattt
ggaagccctttcctaatcaagacagtgacttattggtactaa

DBGET integrated database retrieval system