Capra hircus (goat): 102186040 Help Entry 102186040         CDS       T02910                                  Gene name MAPK1, erk2 Definition (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01522   Endocrine resistance chx01524   Platinum drug resistance chx04010   MAPK signaling pathway chx04012   ErbB signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04022   cGMP-PKG signaling pathway chx04024   cAMP signaling pathway chx04062   Chemokine signaling pathway chx04066   HIF-1 signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04072   Phospholipase D signaling pathway chx04114   Oocyte meiosis chx04140   Autophagy - animal chx04150   mTOR signaling pathway chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04218   Cellular senescence chx04261   Adrenergic signaling in cardiomyocytes chx04270   Vascular smooth muscle contraction chx04350   TGF-beta signaling pathway chx04360   Axon guidance chx04370   VEGF signaling pathway chx04371   Apelin signaling pathway chx04380   Osteoclast differentiation chx04510   Focal adhesion chx04520   Adherens junction chx04540   Gap junction chx04550   Signaling pathways regulating pluripotency of stem cells chx04611   Platelet activation chx04613   Neutrophil extracellular trap formation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04625   C-type lectin receptor signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04662   B cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04666   Fc gamma R-mediated phagocytosis chx04668   TNF signaling pathway chx04713   Circadian entrainment chx04720   Long-term potentiation chx04722   Neurotrophin signaling pathway chx04723   Retrograde endocannabinoid signaling chx04724   Glutamatergic synapse chx04725   Cholinergic synapse chx04726   Serotonergic synapse chx04730   Long-term depression chx04810   Regulation of actin cytoskeleton chx04910   Insulin signaling pathway chx04912   GnRH signaling pathway chx04914   Progesterone-mediated oocyte maturation chx04915   Estrogen signaling pathway chx04916   Melanogenesis chx04917   Prolactin signaling pathway chx04919   Thyroid hormone signaling pathway chx04921   Oxytocin signaling pathway chx04926   Relaxin signaling pathway chx04928   Parathyroid hormone synthesis, secretion and action chx04929   GnRH secretion chx04930   Type II diabetes mellitus chx04933   AGE-RAGE signaling pathway in diabetic complications chx04934   Cushing syndrome chx04935   Growth hormone synthesis, secretion and action chx04960   Aldosterone-regulated sodium reabsorption chx05010   Alzheimer disease chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05034   Alcoholism chx05132   Salmonella infection chx05133   Pertussis chx05135   Yersinia infection chx05140   Leishmaniasis chx05142   Chagas disease chx05145   Toxoplasmosis chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05205   Proteoglycans in cancer chx05206   MicroRNAs in cancer chx05210   Colorectal cancer chx05211   Renal cell carcinoma chx05212   Pancreatic cancer chx05213   Endometrial cancer chx05214   Glioma chx05215   Prostate cancer chx05216   Thyroid cancer chx05218   Melanoma chx05219   Bladder cancer chx05220   Chronic myeloid leukemia chx05221   Acute myeloid leukemia chx05223   Non-small cell lung cancer chx05224   Breast cancer chx05225   Hepatocellular carcinoma chx05226   Gastric cancer chx05230   Central carbon metabolism in cancer chx05231   Choline metabolism in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102186040 (MAPK1)    04012 ErbB signaling pathway     102186040 (MAPK1)    04014 Ras signaling pathway     102186040 (MAPK1)    04015 Rap1 signaling pathway     102186040 (MAPK1)    04350 TGF-beta signaling pathway     102186040 (MAPK1)    04370 VEGF signaling pathway     102186040 (MAPK1)    04371 Apelin signaling pathway     102186040 (MAPK1)    04668 TNF signaling pathway     102186040 (MAPK1)    04066 HIF-1 signaling pathway     102186040 (MAPK1)    04068 FoxO signaling pathway     102186040 (MAPK1)    04072 Phospholipase D signaling pathway     102186040 (MAPK1)    04071 Sphingolipid signaling pathway     102186040 (MAPK1)    04024 cAMP signaling pathway     102186040 (MAPK1)    04022 cGMP-PKG signaling pathway     102186040 (MAPK1)    04151 PI3K-Akt signaling pathway     102186040 (MAPK1)    04150 mTOR signaling pathway     102186040 (MAPK1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102186040 (MAPK1)   09143 Cell growth and death    04114 Oocyte meiosis     102186040 (MAPK1)    04210 Apoptosis     102186040 (MAPK1)    04218 Cellular senescence     102186040 (MAPK1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102186040 (MAPK1)    04520 Adherens junction     102186040 (MAPK1)    04540 Gap junction     102186040 (MAPK1)    04550 Signaling pathways regulating pluripotency of stem cells     102186040 (MAPK1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102186040 (MAPK1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102186040 (MAPK1)    04613 Neutrophil extracellular trap formation     102186040 (MAPK1)    04620 Toll-like receptor signaling pathway     102186040 (MAPK1)    04621 NOD-like receptor signaling pathway     102186040 (MAPK1)    04625 C-type lectin receptor signaling pathway     102186040 (MAPK1)    04650 Natural killer cell mediated cytotoxicity     102186040 (MAPK1)    04660 T cell receptor signaling pathway     102186040 (MAPK1)    04658 Th1 and Th2 cell differentiation     102186040 (MAPK1)    04659 Th17 cell differentiation     102186040 (MAPK1)    04657 IL-17 signaling pathway     102186040 (MAPK1)    04662 B cell receptor signaling pathway     102186040 (MAPK1)    04664 Fc epsilon RI signaling pathway     102186040 (MAPK1)    04666 Fc gamma R-mediated phagocytosis     102186040 (MAPK1)    04062 Chemokine signaling pathway     102186040 (MAPK1)   09152 Endocrine system    04910 Insulin signaling pathway     102186040 (MAPK1)    04929 GnRH secretion     102186040 (MAPK1)    04912 GnRH signaling pathway     102186040 (MAPK1)    04915 Estrogen signaling pathway     102186040 (MAPK1)    04914 Progesterone-mediated oocyte maturation     102186040 (MAPK1)    04917 Prolactin signaling pathway     102186040 (MAPK1)    04921 Oxytocin signaling pathway     102186040 (MAPK1)    04926 Relaxin signaling pathway     102186040 (MAPK1)    04935 Growth hormone synthesis, secretion and action     102186040 (MAPK1)    04919 Thyroid hormone signaling pathway     102186040 (MAPK1)    04928 Parathyroid hormone synthesis, secretion and action     102186040 (MAPK1)    04916 Melanogenesis     102186040 (MAPK1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102186040 (MAPK1)    04270 Vascular smooth muscle contraction     102186040 (MAPK1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102186040 (MAPK1)   09156 Nervous system    04724 Glutamatergic synapse     102186040 (MAPK1)    04725 Cholinergic synapse     102186040 (MAPK1)    04726 Serotonergic synapse     102186040 (MAPK1)    04720 Long-term potentiation     102186040 (MAPK1)    04730 Long-term depression     102186040 (MAPK1)    04723 Retrograde endocannabinoid signaling     102186040 (MAPK1)    04722 Neurotrophin signaling pathway     102186040 (MAPK1)   09158 Development and regeneration    04360 Axon guidance     102186040 (MAPK1)    04380 Osteoclast differentiation     102186040 (MAPK1)   09159 Environmental adaptation    04713 Circadian entrainment     102186040 (MAPK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102186040 (MAPK1)    05206 MicroRNAs in cancer     102186040 (MAPK1)    05205 Proteoglycans in cancer     102186040 (MAPK1)    05203 Viral carcinogenesis     102186040 (MAPK1)    05230 Central carbon metabolism in cancer     102186040 (MAPK1)    05231 Choline metabolism in cancer     102186040 (MAPK1)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102186040 (MAPK1)   09162 Cancer: specific types    05210 Colorectal cancer     102186040 (MAPK1)    05212 Pancreatic cancer     102186040 (MAPK1)    05225 Hepatocellular carcinoma     102186040 (MAPK1)    05226 Gastric cancer     102186040 (MAPK1)    05214 Glioma     102186040 (MAPK1)    05216 Thyroid cancer     102186040 (MAPK1)    05221 Acute myeloid leukemia     102186040 (MAPK1)    05220 Chronic myeloid leukemia     102186040 (MAPK1)    05218 Melanoma     102186040 (MAPK1)    05211 Renal cell carcinoma     102186040 (MAPK1)    05219 Bladder cancer     102186040 (MAPK1)    05215 Prostate cancer     102186040 (MAPK1)    05213 Endometrial cancer     102186040 (MAPK1)    05224 Breast cancer     102186040 (MAPK1)    05223 Non-small cell lung cancer     102186040 (MAPK1)   09164 Neurodegenerative disease    05010 Alzheimer disease     102186040 (MAPK1)    05020 Prion disease     102186040 (MAPK1)    05022 Pathways of neurodegeneration - multiple diseases     102186040 (MAPK1)   09165 Substance dependence    05034 Alcoholism     102186040 (MAPK1)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102186040 (MAPK1)    04933 AGE-RAGE signaling pathway in diabetic complications     102186040 (MAPK1)    04934 Cushing syndrome     102186040 (MAPK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     102186040 (MAPK1)    05135 Yersinia infection     102186040 (MAPK1)    05133 Pertussis     102186040 (MAPK1)    05152 Tuberculosis     102186040 (MAPK1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102186040 (MAPK1)    05170 Human immunodeficiency virus 1 infection     102186040 (MAPK1)    05161 Hepatitis B     102186040 (MAPK1)    05160 Hepatitis C     102186040 (MAPK1)    05171 Coronavirus disease - COVID-19     102186040 (MAPK1)    05164 Influenza A     102186040 (MAPK1)    05163 Human cytomegalovirus infection     102186040 (MAPK1)    05167 Kaposi sarcoma-associated herpesvirus infection     102186040 (MAPK1)    05165 Human papillomavirus infection     102186040 (MAPK1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102186040 (MAPK1)    05140 Leishmaniasis     102186040 (MAPK1)    05142 Chagas disease     102186040 (MAPK1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102186040 (MAPK1)    01524 Platinum drug resistance     102186040 (MAPK1)    01522 Endocrine resistance     102186040 (MAPK1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:chx01001]     102186040 (MAPK1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102186040 (MAPK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102186040 (MAPK1) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102186040 (MAPK1) Protein kinases [BR:chx01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102186040 (MAPK1) Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      102186040 (MAPK1) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102186040 (MAPK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like Motif Other DBs NCBI-GeneID:  102186040 NCBI-ProteinID:  NP_001301131 UniProt:  K7RCQ1 LinkDB All DBs Position Un AA seq 360 aa AA seqDB search MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc tctgcttacgataatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag caccagacgtactgccagaggacgctgagagagataaagatcttgctgcgcttcagacac gagaacatcattggaatcaacgacattattcgggcgccgaccatcgagcagatgaaagac gtatacatagtacaggacctcatggaaacagacctctacaagctcttgaagacgcaacac ctcagcaacgaccacatctgctactttctctaccagatcctcagagggctgaagtatatc cattcagccaacgtgctgcaccgggacctcaagccttccaacctgctgctcaacaccacc tgcgatctcaagatctgtgactttggcctggcccgtgttgcagatccggaccacgaccac acagggttcctgaccgagtacgtggccacgcgctggtaccgggctccagagatcatgctg aactccaagggctacaccaagtccatcgacatttggtccgtgggctgcatcctagcagag atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt ctgggtattcttggatctccgtcgcaggaagacctgaattgcataataaatttaaaagct agaaactatctgctctctcttccacacaaaaataaggtgccgtggaacaggctgttcccg aatgctgactccaaagctctggatttactggacaaaatgttgacgttcaaccctcacaag aggatcgaggtggagcaggctctggcccacccgtacctggagcagtactacgatccaagc gacgagcccgtcgccgaagcacccttcaagtttgacatggaattggatgacttgcccaag gaaaagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatct taa

Capra hircus (goat): 102188824 Help Entry 102188824         CDS       T02910                                  Gene name MAPK3 Definition (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01522   Endocrine resistance chx01524   Platinum drug resistance chx04010   MAPK signaling pathway chx04012   ErbB signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04022   cGMP-PKG signaling pathway chx04024   cAMP signaling pathway chx04062   Chemokine signaling pathway chx04066   HIF-1 signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04072   Phospholipase D signaling pathway chx04114   Oocyte meiosis chx04140   Autophagy - animal chx04150   mTOR signaling pathway chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04218   Cellular senescence chx04261   Adrenergic signaling in cardiomyocytes chx04270   Vascular smooth muscle contraction chx04350   TGF-beta signaling pathway chx04360   Axon guidance chx04370   VEGF signaling pathway chx04371   Apelin signaling pathway chx04380   Osteoclast differentiation chx04510   Focal adhesion chx04520   Adherens junction chx04540   Gap junction chx04550   Signaling pathways regulating pluripotency of stem cells chx04611   Platelet activation chx04613   Neutrophil extracellular trap formation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04625   C-type lectin receptor signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04662   B cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04666   Fc gamma R-mediated phagocytosis chx04668   TNF signaling pathway chx04713   Circadian entrainment chx04720   Long-term potentiation chx04722   Neurotrophin signaling pathway chx04723   Retrograde endocannabinoid signaling chx04724   Glutamatergic synapse chx04725   Cholinergic synapse chx04726   Serotonergic synapse chx04730   Long-term depression chx04810   Regulation of actin cytoskeleton chx04910   Insulin signaling pathway chx04912   GnRH signaling pathway chx04914   Progesterone-mediated oocyte maturation chx04915   Estrogen signaling pathway chx04916   Melanogenesis chx04917   Prolactin signaling pathway chx04919   Thyroid hormone signaling pathway chx04921   Oxytocin signaling pathway chx04926   Relaxin signaling pathway chx04928   Parathyroid hormone synthesis, secretion and action chx04929   GnRH secretion chx04930   Type II diabetes mellitus chx04933   AGE-RAGE signaling pathway in diabetic complications chx04934   Cushing syndrome chx04935   Growth hormone synthesis, secretion and action chx04960   Aldosterone-regulated sodium reabsorption chx05010   Alzheimer disease chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05034   Alcoholism chx05132   Salmonella infection chx05133   Pertussis chx05135   Yersinia infection chx05140   Leishmaniasis chx05142   Chagas disease chx05145   Toxoplasmosis chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05205   Proteoglycans in cancer chx05206   MicroRNAs in cancer chx05210   Colorectal cancer chx05211   Renal cell carcinoma chx05212   Pancreatic cancer chx05213   Endometrial cancer chx05214   Glioma chx05215   Prostate cancer chx05216   Thyroid cancer chx05218   Melanoma chx05219   Bladder cancer chx05220   Chronic myeloid leukemia chx05221   Acute myeloid leukemia chx05223   Non-small cell lung cancer chx05224   Breast cancer chx05225   Hepatocellular carcinoma chx05226   Gastric cancer chx05230   Central carbon metabolism in cancer chx05231   Choline metabolism in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102188824 (MAPK3)    04012 ErbB signaling pathway     102188824 (MAPK3)    04014 Ras signaling pathway     102188824 (MAPK3)    04015 Rap1 signaling pathway     102188824 (MAPK3)    04350 TGF-beta signaling pathway     102188824 (MAPK3)    04370 VEGF signaling pathway     102188824 (MAPK3)    04371 Apelin signaling pathway     102188824 (MAPK3)    04668 TNF signaling pathway     102188824 (MAPK3)    04066 HIF-1 signaling pathway     102188824 (MAPK3)    04068 FoxO signaling pathway     102188824 (MAPK3)    04072 Phospholipase D signaling pathway     102188824 (MAPK3)    04071 Sphingolipid signaling pathway     102188824 (MAPK3)    04024 cAMP signaling pathway     102188824 (MAPK3)    04022 cGMP-PKG signaling pathway     102188824 (MAPK3)    04151 PI3K-Akt signaling pathway     102188824 (MAPK3)    04150 mTOR signaling pathway     102188824 (MAPK3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102188824 (MAPK3)   09143 Cell growth and death    04114 Oocyte meiosis     102188824 (MAPK3)    04210 Apoptosis     102188824 (MAPK3)    04218 Cellular senescence     102188824 (MAPK3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102188824 (MAPK3)    04520 Adherens junction     102188824 (MAPK3)    04540 Gap junction     102188824 (MAPK3)    04550 Signaling pathways regulating pluripotency of stem cells     102188824 (MAPK3)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102188824 (MAPK3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102188824 (MAPK3)    04613 Neutrophil extracellular trap formation     102188824 (MAPK3)    04620 Toll-like receptor signaling pathway     102188824 (MAPK3)    04621 NOD-like receptor signaling pathway     102188824 (MAPK3)    04625 C-type lectin receptor signaling pathway     102188824 (MAPK3)    04650 Natural killer cell mediated cytotoxicity     102188824 (MAPK3)    04660 T cell receptor signaling pathway     102188824 (MAPK3)    04658 Th1 and Th2 cell differentiation     102188824 (MAPK3)    04659 Th17 cell differentiation     102188824 (MAPK3)    04657 IL-17 signaling pathway     102188824 (MAPK3)    04662 B cell receptor signaling pathway     102188824 (MAPK3)    04664 Fc epsilon RI signaling pathway     102188824 (MAPK3)    04666 Fc gamma R-mediated phagocytosis     102188824 (MAPK3)    04062 Chemokine signaling pathway     102188824 (MAPK3)   09152 Endocrine system    04910 Insulin signaling pathway     102188824 (MAPK3)    04929 GnRH secretion     102188824 (MAPK3)    04912 GnRH signaling pathway     102188824 (MAPK3)    04915 Estrogen signaling pathway     102188824 (MAPK3)    04914 Progesterone-mediated oocyte maturation     102188824 (MAPK3)    04917 Prolactin signaling pathway     102188824 (MAPK3)    04921 Oxytocin signaling pathway     102188824 (MAPK3)    04926 Relaxin signaling pathway     102188824 (MAPK3)    04935 Growth hormone synthesis, secretion and action     102188824 (MAPK3)    04919 Thyroid hormone signaling pathway     102188824 (MAPK3)    04928 Parathyroid hormone synthesis, secretion and action     102188824 (MAPK3)    04916 Melanogenesis     102188824 (MAPK3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102188824 (MAPK3)    04270 Vascular smooth muscle contraction     102188824 (MAPK3)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102188824 (MAPK3)   09156 Nervous system    04724 Glutamatergic synapse     102188824 (MAPK3)    04725 Cholinergic synapse     102188824 (MAPK3)    04726 Serotonergic synapse     102188824 (MAPK3)    04720 Long-term potentiation     102188824 (MAPK3)    04730 Long-term depression     102188824 (MAPK3)    04723 Retrograde endocannabinoid signaling     102188824 (MAPK3)    04722 Neurotrophin signaling pathway     102188824 (MAPK3)   09158 Development and regeneration    04360 Axon guidance     102188824 (MAPK3)    04380 Osteoclast differentiation     102188824 (MAPK3)   09159 Environmental adaptation    04713 Circadian entrainment     102188824 (MAPK3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102188824 (MAPK3)    05206 MicroRNAs in cancer     102188824 (MAPK3)    05205 Proteoglycans in cancer     102188824 (MAPK3)    05203 Viral carcinogenesis     102188824 (MAPK3)    05230 Central carbon metabolism in cancer     102188824 (MAPK3)    05231 Choline metabolism in cancer     102188824 (MAPK3)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102188824 (MAPK3)   09162 Cancer: specific types    05210 Colorectal cancer     102188824 (MAPK3)    05212 Pancreatic cancer     102188824 (MAPK3)    05225 Hepatocellular carcinoma     102188824 (MAPK3)    05226 Gastric cancer     102188824 (MAPK3)    05214 Glioma     102188824 (MAPK3)    05216 Thyroid cancer     102188824 (MAPK3)    05221 Acute myeloid leukemia     102188824 (MAPK3)    05220 Chronic myeloid leukemia     102188824 (MAPK3)    05218 Melanoma     102188824 (MAPK3)    05211 Renal cell carcinoma     102188824 (MAPK3)    05219 Bladder cancer     102188824 (MAPK3)    05215 Prostate cancer     102188824 (MAPK3)    05213 Endometrial cancer     102188824 (MAPK3)    05224 Breast cancer     102188824 (MAPK3)    05223 Non-small cell lung cancer     102188824 (MAPK3)   09164 Neurodegenerative disease    05010 Alzheimer disease     102188824 (MAPK3)    05020 Prion disease     102188824 (MAPK3)    05022 Pathways of neurodegeneration - multiple diseases     102188824 (MAPK3)   09165 Substance dependence    05034 Alcoholism     102188824 (MAPK3)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102188824 (MAPK3)    04933 AGE-RAGE signaling pathway in diabetic complications     102188824 (MAPK3)    04934 Cushing syndrome     102188824 (MAPK3)   09171 Infectious disease: bacterial    05132 Salmonella infection     102188824 (MAPK3)    05135 Yersinia infection     102188824 (MAPK3)    05133 Pertussis     102188824 (MAPK3)    05152 Tuberculosis     102188824 (MAPK3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102188824 (MAPK3)    05170 Human immunodeficiency virus 1 infection     102188824 (MAPK3)    05161 Hepatitis B     102188824 (MAPK3)    05160 Hepatitis C     102188824 (MAPK3)    05171 Coronavirus disease - COVID-19     102188824 (MAPK3)    05164 Influenza A     102188824 (MAPK3)    05163 Human cytomegalovirus infection     102188824 (MAPK3)    05167 Kaposi sarcoma-associated herpesvirus infection     102188824 (MAPK3)    05165 Human papillomavirus infection     102188824 (MAPK3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102188824 (MAPK3)    05140 Leishmaniasis     102188824 (MAPK3)    05142 Chagas disease     102188824 (MAPK3)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102188824 (MAPK3)    01524 Platinum drug resistance     102188824 (MAPK3)    01522 Endocrine resistance     102188824 (MAPK3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:chx01001]     102188824 (MAPK3)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     102188824 (MAPK3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102188824 (MAPK3) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102188824 (MAPK3) Protein kinases [BR:chx01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102188824 (MAPK3) Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      102188824 (MAPK3) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102188824 (MAPK3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2 NDUF_B4 Motif Other DBs NCBI-GeneID:  102188824 NCBI-ProteinID:  XP_017896269 UniProt:  A0A452EU65 LinkDB All DBs Position 25 AA seq 380 aa AA seqDB search MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER LKELIFQETARFQPGVLEAS NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg gtcggcccgggggtcccgggggaggtggagatagtaaaggggcagccgttcgacgtgggc ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct tacgaccatgtgcgcaagactcgagtggccatcaagaagatcagcccctttgagcatcag acctactgccagcgcacgttgcgagagattcagattctgctgcgcttccgccatgagaac gtcattggtatccgagacattctgcgagcacccaccctggaagccatgagggatgtctac atcgtgcaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc aacgaccatgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc ttcttgacggaatatgtggccacacgctggtaccgggccccagagatcatgcttaactcc aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt attctgggctccccatcccaggaggacctgaactgtatcatcaacatgaaagcccgaaac tacctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtca gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcctcc taa

DBGET integrated database retrieval system